Array
(
[_title] => Histone H2AFV Rabbit pAb
[_Synonyms] => H2AV; H2AFV; H2A.Z-2; Histone H2AFV
[_keywords] => 94239, H2AFV, H2A.Z-2, H2AV, H2A histone family member V, histone H2A.V, H2A.F/Z, histone H2A.F/Z, purine-rich binding element protein B, Q71UI9, H2afv, H2A Histone Family Member V, Purine-Rich Binding Element Protein B, H2A Histone Family, Member V, Histone H2A.F/Z, Histone H2A.V, Histone H2AFV,KO/KDantibody94239, H2AFV, H2A.Z-2, H2AV, H2A histone family member V, histone H2A.V, H2A.F/Z, histone H2A.F/Z, purine-rich binding element protein B, Q71UI9, H2afv, H2A Histone Family Member V, Purine-Rich Binding Element Protein B, H2A Histone Family, Member V, Histone H2A.F/Z, Histone H2A.V, Histone H2AFV,PTMantibody
[_Symbol] => H2AZ2
[_GeneID] => 94239
[id] => 18751
[catid] => 131
[title] => Histone H2AFV Rabbit pAb
[url] => /catalog/A17813
[price] => 50 μL,950,|100 μL,1580,|200 μL,2620,
[CatalogNo] => A17813
[Synonyms] => H2AV; H2AFV; H2A.Z-2; Histone H2AFV
[description] => Histone H2AFV Rabbit pAb
[applications] => ELISA,WB,IHC-P,IF/ICC
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat
[field_s2] => 13kDa
[field_s3] => 14kDa
[field_s4] => Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human Histone H2AFV (NP_036544.1).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => WB,1:500 - 1:2000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
[field_s8] =>
[field_s9] => Unmodified
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => 94239, H2AFV, H2A.Z-2, H2AV, H2A histone family member V, histone H2A.V, H2A.F/Z, histone H2A.F/Z, purine-rich binding element protein B, Q71UI9, H2afv, H2A Histone Family Member V, Purine-Rich Binding Element Protein B, H2A Histone Family, Member V, Histone H2A.F/Z, Histone H2A.V, Histone H2AFV,KO/KD抗体94239, H2AFV, H2A.Z-2, H2AV, H2A histone family member V, histone H2A.V, H2A.F/Z, histone H2A.F/Z, purine-rich binding element protein B, Q71UI9, H2afv, H2A Histone Family Member V, Purine-Rich Binding Element Protein B, H2A Histone Family, Member V, Histone H2A.F/Z, Histone H2A.V, Histone H2AFV,PTM抗体
[field_l3] => MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17813_P16023_WB_01.jpg?t=1715043625|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17813_P16023_IHC_01.jpg?t=1715043625|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17813_P16023_IF_01.jpg?t=1715043625|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17813_P16023_IF_02.jpg?t=1715043625|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17813_P16023_IF_03.jpg?t=1715043625
[Review] => 0
[Publication] => 0
[MoleculeName] => H2AFV
[recommend] => 0
[status] => 1
[Symbol] => H2AZ2
[posid] => 0
[GeneID] => Array
(
[0] => 94239
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 111
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => Histone H2B (testis specific) Rabbit pAb
[_Synonyms] => STBP; TH2B; H2BFU; TSH2B; hTSH2B; TSH2B.1; HIST1H2BA; bA317E16.3; Histone H2B (testis specific)
[_keywords] => STBP, TH2B, H2BFU, TSH2B, hTSH2B, TSH2B.1, HIST1H2BA, bA317E16.3, Histone H2B (testis specific),PTMantibody
[_Symbol] => H2BC1
[_GeneID] => 255626
[id] => 34603
[catid] => 131
[title] => Histone H2B (testis specific) Rabbit pAb
[url] => /catalog/A23044
[price] => 50 μL,900,In Stock|100 μL,1500,In Stock|200 μL,2450,In Stock
[CatalogNo] => A23044
[Synonyms] => STBP; TH2B; H2BFU; TSH2B; hTSH2B; TSH2B.1; HIST1H2BA; bA317E16.3; Histone H2B (testis specific)
[description] => Histone H2B (testis specific) Rabbit pAb
[applications] => ELISA,WB
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat
[field_s2] => 14kDa
[field_s3] => 15kDa/20kDa
[field_s4] => Recombinant protein of human Histone H2B (testis specific).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => WB,1:500 - 1:1000
[field_s8] =>
[field_s9] => Unmodified
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => STBP, TH2B, H2BFU, TSH2B, hTSH2B, TSH2B.1, HIST1H2BA, bA317E16.3, Histone H2B (testis specific),PTM抗体
[field_l3] =>
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A23044_N19431-5_WB_01.jpg?t=1708391956|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A23044_N19431-5_WB_02.jpg?t=1708391956
[Review] => 0
[Publication] => 0
[MoleculeName] =>
[recommend] => 0
[status] => 1
[Symbol] => H2BC1
[posid] => 0
[GeneID] => Array
(
[0] => 255626
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 111
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => Histone H2B Rabbit pAb
[_Synonyms] => H2B; H2BE; H2BQ; GL105; H2B.1; H2BFQ; H2BGL105; H2B-GL105; HIST2H2BE; Histone H2B
[_keywords] => 8349, HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family member e, histone H2B type 2-E, H2B histone family, member Q, histone 2, H2be, histone H2B-GL105, histone H2B.q, histone cluster 2, Q16778, Histone Cluster 2 H2B Family Member E, H2B Histone Family, Member Q, Histone Cluster 2, Histone H2B-GL105, Histone 2, Histone H2B.Q, Histone H2B Type 2-E, H2B/Q, Histone H2B,KO/KDantibody8349, HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family member e, histone H2B type 2-E, H2B histone family, member Q, histone 2, H2be, histone H2B-GL105, histone H2B.q, histone cluster 2, Q16778, Histone Cluster 2 H2B Family Member E, H2B Histone Family, Member Q, Histone Cluster 2, Histone H2B-GL105, Histone 2, Histone H2B.Q, Histone H2B Type 2-E, H2B/Q, Histone H2B,PTMantibody
[_Symbol] => H2BC21
[_GeneID] => 3017/8349
[id] => 18920
[catid] => 131
[title] => Histone H2B Rabbit pAb
[url] => /catalog/A18305
[price] => 50 μL,900,In Stock|100 μL,1500,In Stock|200 μL,2450,In Stock
[CatalogNo] => A18305
[Synonyms] => H2B; H2BE; H2BQ; GL105; H2B.1; H2BFQ; H2BGL105; H2B-GL105; HIST2H2BE; Histone H2B
[description] => Histone H2B Rabbit pAb
[applications] => ELISA,WB
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 14kDa
[field_s3] => 14kDa
[field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2B (NP_003519.1).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => WB,1:500 - 1:1000
[field_s8] =>
[field_s9] =>
[field_s10] =>
[field_s12] =>
[keywords] => 8349, HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family member e, histone H2B type 2-E, H2B histone family, member Q, histone 2, H2be, histone H2B-GL105, histone H2B.q, histone cluster 2, Q16778, Histone Cluster 2 H2B Family Member E, H2B Histone Family, Member Q, Histone Cluster 2, Histone H2B-GL105, Histone 2, Histone H2B.Q, Histone H2B Type 2-E, H2B/Q, Histone H2B,KO/KD抗体8349, HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family member e, histone H2B type 2-E, H2B histone family, member Q, histone 2, H2be, histone H2B-GL105, histone H2B.q, histone cluster 2, Q16778, Histone Cluster 2 H2B Family Member E, H2B Histone Family, Member Q, Histone Cluster 2, Histone H2B-GL105, Histone 2, Histone H2B.Q, Histone H2B Type 2-E, H2B/Q, Histone H2B,PTM抗体
[field_l3] => MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVR
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A18305_Q5597(H)(C)_WB_01.jpg?t=1713322663
[Review] => 0
[Publication] => 0
[MoleculeName] => HIST2H2BE
[recommend] => 0
[status] => 1
[Symbol] => H2BC21
[posid] => 0
[GeneID] => Array
(
[0] => 3017
[1] => 8349
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 111
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => Histone H3 Rabbit pAb
[_Synonyms] => H3/b; H3C1; H3C2; H3C3; H3C6; H3C7; H3C8; H3FB; H3C10; H3C11; H3C12; HIST1H3D; Histone H3
[_keywords] => 8351, HIST1H3D, H3/b, H3FB, histone cluster 1 H3 family member d, histone H3.1, H3 histone family, member B, histone 1, H3d, histone H3/b, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member D, H3 Histone Family, Member B, Histone Cluster 1, Histone 1, Histone H3/B, Histone H3.1, Histone H3/A, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3/B, H3FA, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, HIST1H3A, HIST1H3B, HIST1H3C, HIST1H3E, HIST1H3F, HIST1H3G, HIST1H3H, HIST1H3I, HIST1H3J, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/i, Histone H3/j, Histone H3/k, Histone H3/l, H3,PTMantibody
[_Symbol] => H3C4
[_GeneID] => 8290/8350
[id] => 4716
[catid] => 131
[title] => Histone H3 Rabbit pAb
[url] => /catalog/A7010
[price] => 50 μL,950,In Stock|100 μL,1580,In Stock|200 μL,2620,In Stock
[CatalogNo] => A7010
[Synonyms] => H3/b; H3C1; H3C2; H3C3; H3C6; H3C7; H3C8; H3FB; H3C10; H3C11; H3C12; HIST1H3D; Histone H3
[description] => Histone H3 Rabbit pAb
[applications] => ELISA,WB,IHC-P
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 15kDa
[field_s3] => 15kDa
[field_s4] => Recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human HIST1H3D (NP_003520.1).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => WB,1:500 - 1:2000
IHC-P,1:50 - 1:200
[field_s8] => yes
[field_s9] => Unmodified
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => 8351, HIST1H3D, H3/b, H3FB, histone cluster 1 H3 family member d, histone H3.1, H3 histone family, member B, histone 1, H3d, histone H3/b, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member D, H3 Histone Family, Member B, Histone Cluster 1, Histone 1, Histone H3/B, Histone H3.1, Histone H3/A, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3/B, H3FA, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, HIST1H3A, HIST1H3B, HIST1H3C, HIST1H3E, HIST1H3F, HIST1H3G, HIST1H3H, HIST1H3I, HIST1H3J, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/i, Histone H3/j, Histone H3/k, Histone H3/l, H3,PTM抗体
[field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7010_P3299_WB_01.jpg?t=1715133513|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7010_P3299_IHC_01.jpg?t=1715133513|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7010_P3299_IHC_04.jpg?t=1715133513|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7010_P3299_IHC_06.jpg?t=1715133513
[Review] => 0
[Publication] => 0
[MoleculeName] => HIST1H3A
[recommend] => 0
[status] => 1
[Symbol] => H3C4
[posid] => 0
[GeneID] => Array
(
[0] => 8290
[1] => 8350
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 111
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
(C)_WB_01.jpg?t=1713322663)
