我们为您找到 His 的 3 个相关产品结果。 您可以根据左侧筛选功能来找到您需要的产品。

Array ( [_title] => Histone H2B Rabbit mAb [_Synonyms] => H2B; H2BE; H2BQ; GL105; H2B.1; H2BFQ; H2BGL105; H2B-GL105; HIST2H2BE; Formyl-Histone H2B-K108 [_keywords] => HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family member e, histone H2B type 2-E, H2B histone family, member Q, histone 2, H2be, histone H2B-GL105, histone H2B.q, histone cluster 2, Q16778, 8349, H2B/q, Histone H2B, Histone H2B GL105, Histone H2B type 2 E, Histone H2B.q, Unconjugated, Formyl-Histone H2B-K108,KO/KDantibodyHIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family member e, histone H2B type 2-E, H2B histone family, member Q, histone 2, H2be, histone H2B-GL105, histone H2B.q, histone cluster 2, Q16778, 8349, H2B/q, Histone H2B, Histone H2B GL105, Histone H2B type 2 E, Histone H2B.q, Unconjugated, Formyl-Histone H2B-K108,PTMantibody [_Symbol] => H2BC21 [_GeneID] => 3017/8349 [id] => 45020 [catid] => 130 [title] => Histone H2B Rabbit mAb [url] => /catalog/A26075 [price] => 50 μL,1200,In Stock|100 μL,2200,In Stock|200 μL,3100,In Stock [CatalogNo] => A26075 [Synonyms] => H2B; H2BE; H2BQ; GL105; H2B.1; H2BFQ; H2BGL105; H2B-GL105; HIST2H2BE; Formyl-Histone H2B-K108 [description] => Histone H2B Rabbit mAb [applications] => ELISA,WB,IHC-P,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => 14kDa [field_s3] => 17kDa [field_s4] => Recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human Histone H2B (NP_003519.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:2000 - 1:4000
ChIP,3 μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family member e, histone H2B type 2-E, H2B histone family, member Q, histone 2, H2be, histone H2B-GL105, histone H2B.q, histone cluster 2, Q16778, 8349, H2B/q, Histone H2B, Histone H2B GL105, Histone H2B type 2 E, Histone H2B.q, Unconjugated, Formyl-Histone H2B-K108,KO/KD抗体HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family member e, histone H2B type 2-E, H2B histone family, member Q, histone 2, H2be, histone H2B-GL105, histone H2B.q, histone cluster 2, Q16778, 8349, H2B/q, Histone H2B, Histone H2B GL105, Histone H2B type 2 E, Histone H2B.q, Unconjugated, Formyl-Histone H2B-K108,PTM抗体 [field_l3] => MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A26075_ARC68307-01_WB_01.jpg?t=1718275896|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A26075_ARC68307-01_IHC_01.jpg?t=1718275896|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A26075_ARC68307-01_IHC_02.jpg?t=1718275896|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A26075_ARC68307-01_IHC_03.jpg?t=1718275896|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A26075_ARC68307-01_IHC_04.jpg?t=1718275896|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A26075_ARC68307-01_IHC_05.jpg?t=1718275896|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A26075_ARC68307-01_ChIP_01.jpg?t=1718275896 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H2BC21 [posid] => 0 [GeneID] => Array ( [0] => 3017 [1] => 8349 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Acetyl-Histone H2B-K12 Rabbit pAb [_Synonyms] => H2B; H2BE; H2BQ; GL105; H2B.1; H2BFQ; H2BGL105; H2B-GL105; HIST2H2BE; Acetyl-Histone H2B-K12 [_keywords] => 8349, HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family member e, histone H2B type 2-E, H2B histone family, member Q, histone 2, H2be, histone H2B-GL105, histone H2B.q, histone cluster 2, Q16778, Histone Cluster 2 H2B Family Member E, H2B Histone Family, Member Q, Histone Cluster 2, Histone H2B-GL105, Histone 2, Histone H2B.Q, Histone H2B Type 2-E, H2B/Q, Histone H2B, Acetyl-Histone H2B-K12, H2BK12,KO/KDantibody8349, HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family member e, histone H2B type 2-E, H2B histone family, member Q, histone 2, H2be, histone H2B-GL105, histone H2B.q, histone cluster 2, Q16778, Histone Cluster 2 H2B Family Member E, H2B Histone Family, Member Q, Histone Cluster 2, Histone H2B-GL105, Histone 2, Histone H2B.Q, Histone H2B Type 2-E, H2B/Q, Histone H2B, Acetyl-Histone H2B-K12, H2BK12,PTMantibody8349, HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family member e, histone H2B type 2-E, H2B histone fami [_Symbol] => H2BC21 [_GeneID] => 3017/8349 [id] => 10202 [catid] => 722 [title] => Acetyl-Histone H2B-K12 Rabbit pAb [url] => /catalog/A15619 [price] => 50 μL,1180,In Stock|100 μL,1860,In Stock|200 μL,2980,In Stock [CatalogNo] => A15619 [Synonyms] => H2B; H2BE; H2BQ; GL105; H2B.1; H2BFQ; H2BGL105; H2B-GL105; HIST2H2BE; Acetyl-Histone H2B-K12 [description] => Acetyl-Histone H2B-K12 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 14kDa [field_s3] => 14kDa [field_s4] => A synthetic acetylated peptide around K12 of human Histone H2B (NP_003519.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => yes [field_s9] => Acetyl K12 [field_s10] => Unconjugated [field_s12] => [keywords] => 8349, HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family member e, histone H2B type 2-E, H2B histone family, member Q, histone 2, H2be, histone H2B-GL105, histone H2B.q, histone cluster 2, Q16778, Histone Cluster 2 H2B Family Member E, H2B Histone Family, Member Q, Histone Cluster 2, Histone H2B-GL105, Histone 2, Histone H2B.Q, Histone H2B Type 2-E, H2B/Q, Histone H2B, Acetyl-Histone H2B-K12, H2BK12,KO/KD抗体8349, HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family member e, histone H2B type 2-E, H2B histone family, member Q, histone 2, H2be, histone H2B-GL105, histone H2B.q, histone cluster 2, Q16778, Histone Cluster 2 H2B Family Member E, H2B Histone Family, Member Q, Histone Cluster 2, Histone H2B-GL105, Histone 2, Histone H2B.Q, Histone H2B Type 2-E, H2B/Q, Histone H2B, Acetyl-Histone H2B-K12, H2BK12,PTM抗体8349, HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family member e, histone H2B type 2-E, H2B histone fami [field_l3] => APKKG [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A15619_Q5598(H)(A)_WB_01.jpg?t=1715654505|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A15619_Q5595(H)(A)(2)_IHC_01.jpg?t=1715654505|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A15619_Q5595(H)(A)(2)_IHC_02.jpg?t=1715654505|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A15619_Q5595(H)(A)(2)_IHC_03.jpg?t=1715654505|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A15619_Q5599-5(A)_IF_01.jpg?t=1715654505|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A15619_Q5599-5(A)_IF_02.jpg?t=1715654505|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A15619_Q5599-5(A)_IF_03.jpg?t=1715654505|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A15619_Q5597(H)(A)_ChIP_01.jpg?t=1715654505 [Review] => 0 [Publication] => 1 [MoleculeName] => H2B K12ac [recommend] => 0 [status] => 1 [Symbol] => H2BC21 [posid] => 1 [GeneID] => Array ( [0] => 3017 [1] => 8349 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Acetyl-Histone H2B-K20 Rabbit pAb [_Synonyms] => H2B; H2BE; H2BQ; GL105; H2B.1; H2BFQ; H2BGL105; H2B-GL105; HIST2H2BE; Acetyl-Histone H2B-K20 [_keywords] => 8349, HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family member e, histone H2B type 2-E, H2B histone family, member Q, histone 2, H2be, histone H2B-GL105, histone H2B.q, histone cluster 2, Q16778, Histone Cluster 2 H2B Family Member E, H2B Histone Family, Member Q, Histone Cluster 2, Histone H2B-GL105, Histone 2, Histone H2B.Q, Histone H2B Type 2-E, H2B/Q, Histone H2B, Acetyl-Histone H2B-K12, H2BK12, Acetyl-Histone H2B-K20,KO/KDantibody8349, HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family member e, histone H2B type 2-E, H2B histone family, member Q, histone 2, H2be, histone H2B-GL105, histone H2B.q, histone cluster 2, Q16778, Histone Cluster 2 H2B Family Member E, H2B Histone Family, Member Q, Histone Cluster 2, Histone H2B-GL105, Histone 2, Histone H2B.Q, Histone H2B Type 2-E, H2B/Q, Histone H2B, Acetyl-Histone H2B-K12, H2BK12, Acetyl-Histone H2B-K20,PTMantibody8349, HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family [_Symbol] => H2BC21 [_GeneID] => 3017/8349 [id] => 42914 [catid] => 722 [title] => Acetyl-Histone H2B-K20 Rabbit pAb [url] => /catalog/A24886 [price] => 50 μL,1180,In Stock|100 μL,1860,In Stock|200 μL,2980,In Stock [CatalogNo] => A24886 [Synonyms] => H2B; H2BE; H2BQ; GL105; H2B.1; H2BFQ; H2BGL105; H2B-GL105; HIST2H2BE; Acetyl-Histone H2B-K20 [description] => Acetyl-Histone H2B-K20 Rabbit pAb [applications] => ELISA,WB,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => 14kDa [field_s3] => 17kDa [field_s4] => A synthetic acetylated peptide around K20 of human Histone H2B (NP_003519.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => Acetyl K20 [field_s10] => Unconjugated [field_s12] => [keywords] => 8349, HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family member e, histone H2B type 2-E, H2B histone family, member Q, histone 2, H2be, histone H2B-GL105, histone H2B.q, histone cluster 2, Q16778, Histone Cluster 2 H2B Family Member E, H2B Histone Family, Member Q, Histone Cluster 2, Histone H2B-GL105, Histone 2, Histone H2B.Q, Histone H2B Type 2-E, H2B/Q, Histone H2B, Acetyl-Histone H2B-K12, H2BK12, Acetyl-Histone H2B-K20,KO/KD抗体8349, HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family member e, histone H2B type 2-E, H2B histone family, member Q, histone 2, H2be, histone H2B-GL105, histone H2B.q, histone cluster 2, Q16778, Histone Cluster 2 H2B Family Member E, H2B Histone Family, Member Q, Histone Cluster 2, Histone H2B-GL105, Histone 2, Histone H2B.Q, Histone H2B Type 2-E, H2B/Q, Histone H2B, Acetyl-Histone H2B-K12, H2BK12, Acetyl-Histone H2B-K20,PTM抗体8349, HIST2H2BE, GL105, H2B, H2B.1, H2BFQ, H2BGL105, H2BQ, histone cluster 2 H2B family [field_l3] => [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A24886_N17946-5(A)_WB_02.jpg?t=1715754222|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A24886_N17946-5(A)_ChIP_01.jpg?t=1715754222 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H2BC21 [posid] => 0 [GeneID] => Array ( [0] => 3017 [1] => 8349 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )