Array
(
[_title] => Histone H3.3 Rabbit mAb
[_Synonyms] => H3F3; H3-3B; H3.3A; H3F3A; BRYLIB1; Histone H3.3
[_keywords] => H3F3A, H3.3A, H3F3, H3 histone family member 3A, histone H3.3|H3 histone, family 3A, P84243, H3.3, Histone H3.3,KO/KDantibodyH3F3A, H3.3A, H3F3, H3 histone family member 3A, histone H3.3|H3 histone, family 3A, P84243, H3.3, Histone H3.3,PTMantibody
[_Symbol] => H3-3A
[_GeneID] => 3020
[id] => 21557
[catid] => 130
[title] => Histone H3.3 Rabbit mAb
[url] => /catalog/A4835
[price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock
[CatalogNo] => A4835
[Synonyms] => H3F3; H3-3B; H3.3A; H3F3A; BRYLIB1; Histone H3.3
[description] => Histone H3.3 Rabbit mAb
[applications] => ELISA,WB,IHC-P,ChIP,ChIP-seq
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 15kDa
[field_s3] => 17kDa
[field_s4] => A synthetic peptide corresponding to a sequence within amino acids 57-136 of human Histone H3.3 (P84243).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => WB,1:500 - 1:2000
IHC-P,1:50 - 1:200
ChIP,2μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:50 - 1:200
[field_s8] =>
[field_s9] => Unmodified
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => H3F3A, H3.3A, H3F3, H3 histone family member 3A, histone H3.3|H3 histone, family 3A, P84243, H3.3, Histone H3.3,KO/KD抗体H3F3A, H3.3A, H3F3, H3 histone family member 3A, histone H3.3|H3 histone, family 3A, P84243, H3.3, Histone H3.3,PTM抗体
[field_l3] => KSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4835_ARC0255_ChIP-seq_01.jpg?t=1715074050|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4835_ARC0255_WB_01.jpg?t=1715074050|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4835_ARC0255_WB_02.jpg?t=1715074050|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4835_ARC0255_IHC_01.jpg?t=1715074050|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4835_ARC0255_IHC_02.jpg?t=1715074050|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4835_ARC0255_IHC_03.jpg?t=1715074050|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4835_ARC0255_ChIP_01.jpg?t=1715074050
[Review] => 1
[Publication] => 0
[MoleculeName] =>
[recommend] => 1
[status] => 1
[Symbol] => H3-3A
[posid] => 0
[GeneID] => Array
(
[0] => 3020
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 110
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
