Array
(
[_title] => Histone H2B Rabbit mAb
[_Synonyms] => H2BK; H2B/S; H2BFT; H2BFAiii; HIST1H2BK; Histone H2B
[_keywords] => HIST1H2BK, H2B/S, H2BFAiii, H2BFT, H2BK, histone cluster 1 H2B family member k, histone H2B type 1-K|H2B K|H2B histone family, member T|HIRA-interacting protein 1|histone 1, H2bk|histone cluster 1, H2bk|histone family member, O60814, Histone H2B,KO/KDantibodyHIST1H2BK, H2B/S, H2BFAiii, H2BFT, H2BK, histone cluster 1 H2B family member k, histone H2B type 1-K|H2B K|H2B histone family, member T|HIRA-interacting protein 1|histone 1, H2bk|histone cluster 1, H2bk|histone family member, O60814, Histone H2B,PTMantibody
[_Symbol] => H2BC12
[_GeneID] => 3017/8349
[id] => 24077
[catid] => 130
[title] => Histone H2B Rabbit mAb
[url] => /catalog/A19812
[price] => 50 μL,1200,In Stock|100 μL,2200,In Stock|200 μL,3100,In Stock
[CatalogNo] => A19812
[Synonyms] => H2BK; H2B/S; H2BFT; H2BFAiii; HIST1H2BK; Histone H2B
[description] => Histone H2B Rabbit mAb
[applications] => ELISA,WB,IHC-P
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 14kDa
[field_s3] => 17kDa
[field_s4] => A synthetic peptide corresponding to a sequence within amino acids 47-126 of human Histone H2B (O60814).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
[field_s8] =>
[field_s9] => Unmodified
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => HIST1H2BK, H2B/S, H2BFAiii, H2BFT, H2BK, histone cluster 1 H2B family member k, histone H2B type 1-K|H2B K|H2B histone family, member T|HIRA-interacting protein 1|histone 1, H2bk|histone cluster 1, H2bk|histone family member, O60814, Histone H2B,KO/KD抗体HIST1H2BK, H2B/S, H2BFAiii, H2BFT, H2BK, histone cluster 1 H2B family member k, histone H2B type 1-K|H2B K|H2B histone family, member T|HIRA-interacting protein 1|histone 1, H2bk|histone cluster 1, H2bk|histone family member, O60814, Histone H2B,PTM抗体
[field_l3] => KQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19812_ARC2337_WB-01.jpg?t=1713322852|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19812_ARC2337_IHC_01.jpg?t=1713322852|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19812_ARC2337_IHC_02.jpg?t=1713322852|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19812_ARC2337_IHC_03.jpg?t=1713322852|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19812_ARC2337_IHC_04.jpg?t=1713322852|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19812_ARC2337_IHC_05.jpg?t=1713322852|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19812_ARC2337_IHC_06.jpg?t=1713322852
[Review] => 0
[Publication] => 1
[MoleculeName] =>
[recommend] => 0
[status] => 1
[Symbol] => H2BC12
[posid] => 0
[GeneID] => Array
(
[0] => 3017
[1] => 8349
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 110
[datasheet] =>
[validation] => 0
[status_cn] => 1
)