Array
(
[_title] => Histone H4 Rabbit mAb
[_Synonyms] => H4/p; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; HIST4H4; Histone H4
[_keywords] => HIST4H4, H4/p, histone cluster 4 H4, histone H4|histone 4, H4, P62805, Histone H4,KO/KDantibodyHIST4H4, H4/p, histone cluster 4 H4, histone H4|histone 4, H4, P62805, Histone H4,PTMantibody
[_Symbol] => H4C16
[_GeneID] => 8359
[id] => 24130
[catid] => 130
[title] => Histone H4 Rabbit mAb
[url] => /catalog/A19815
[price] => 50 μL,1200,In Stock|100 μL,2200,In Stock|200 μL,3100,In Stock
[CatalogNo] => A19815
[Synonyms] => H4/p; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; HIST4H4; Histone H4
[description] => Histone H4 Rabbit mAb
[applications] => ELISA,WB,IHC-P
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 11kDa
[field_s3] => 11kDa
[field_s4] => A synthetic peptide corresponding to a sequence within amino acids 24-103 of human Histone H4 (P62805).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
[field_s8] =>
[field_s9] => Unmodified
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => HIST4H4, H4/p, histone cluster 4 H4, histone H4|histone 4, H4, P62805, Histone H4,KO/KD抗体HIST4H4, H4/p, histone cluster 4 H4, histone H4|histone 4, H4, P62805, Histone H4,PTM抗体
[field_l3] => RDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19815_ARC2340_WB-01.jpg?t=1714988361|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19815_ARC2340_IHC_01.jpg?t=1714988361|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19815_ARC2340_IHC_02.jpg?t=1714988361|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19815_ARC2340_IHC_03.jpg?t=1714988361
[Review] => 0
[Publication] => 0
[MoleculeName] =>
[recommend] => 0
[status] => 1
[Symbol] => H4C16
[posid] => 0
[GeneID] => Array
(
[0] => 8359
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 110
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
