我们为您找到 His 的 4 个相关产品结果。 您可以根据左侧筛选功能来找到您需要的产品。

Array ( [_title] => TriMethyl-Histone H3-K27 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, H [_Symbol] => H3C1/H3-4 [_GeneID] => 8290/8350 [id] => 34064 [catid] => 413 [title] => TriMethyl-Histone H3-K27 Rabbit mAb [url] => /catalog/A22396 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22396 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [description] => TriMethyl-Histone H3-K27 Rabbit mAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP,CUT&Tag [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic trimethylated peptide around K27 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:10000 - 1:160000
IHC-P,1:500 - 1:1000
IF/ICC,1:500 - 1:1000
ChIP,5μg antibody for 5μg-10μg of Chromatin
CUT&Tag, 10⁵ cells /1 μg [field_s8] => [field_s9] => TriMethyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, H [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22396_ARC54167-01_ChIP-seq_01.jpg?t=1715046315|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22396_ARC54167-01_WB_01.jpg?t=1715046315|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22396_ARC54167-01_IHC_01.jpg?t=1715046315|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22396_ARC54167-01_IHC_02.jpg?t=1715046315|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22396_ARC54167-01_IF_01.jpg?t=1715046315|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22396_ARC54167-01_ChIP_01.jpg?t=1715046315 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1/H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H3-K27 Rabbit pAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3 [_Symbol] => H3C1 [_GeneID] => 8290/8350 [id] => 8314 [catid] => 413 [title] => MonoMethyl-Histone H3-K27 Rabbit pAb [url] => /catalog/A2361 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2361 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K27 [description] => MonoMethyl-Histone H3-K27 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic monomethylated peptide around K27 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => yes [field_s9] => MonoMethyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3 [field_l3] => ARKSA [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_N2510(11-12)(Me)_WB_01.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_E458(Me)_DB_01.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_E458(Me)PuFt_IHC_01.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_E458(Me)PuFt_IHC_02.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_E458(Me)PuFt_IHC_03.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_N20652-5(Me)_IF_01.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_N20652-5(Me)_IF_02.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_N20655-5(Me)_ChIP_01.jpg?t=1715048281 [Review] => 1 [Publication] => 6 [MoleculeName] => H3K27me1 [recommend] => 0 [status] => 1 [Symbol] => H3C1 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Asymmetric DiMethyl-Histone H3-R17 [_keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, Asymmetric DiMethyl R17, H3R17, marker, Chromatin, Chromatin marker, Asymmetric DiMethyl-Histone H3-R17,PTMantibody8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone [_Symbol] => H3C1 [_GeneID] => 8290/8350 [id] => 19595 [catid] => 413 [title] => Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb [url] => /catalog/A17899 [price] => 50 μL,1260,In Stock|100 μL,2000,In Stock|200 μL,3260,In Stock [CatalogNo] => A17899 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Asymmetric DiMethyl-Histone H3-R17 [description] => Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic asymmetric dimethylated peptide around R17 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200 [field_s8] => [field_s9] => Asymmetric DiMethyl R17 [field_s10] => Unconjugated [field_s12] => [keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, Asymmetric DiMethyl R17, H3R17, marker, Chromatin, Chromatin marker, Asymmetric DiMethyl-Histone H3-R17,PTM抗体8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone [field_l3] => APRKQ [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17899_N2527(6-9)(Me)_WB_02.jpg?t=1715134187|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17899_N2529-5(Me)_IHC_01.jpg?t=1715134187|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17899_N2527-5(Me)_IF_01.jpg?t=1715134187 [Review] => 0 [Publication] => 0 [MoleculeName] => H3R17me2a [recommend] => 0 [status] => 1 [Symbol] => H3C1 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H3-R17 Rabbit pAb [_Synonyms] => H3/j; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FJ; H3C10; H3C11; HIST1H3J; MonoMethyl-Histone H3-R17 [_keywords] => 8356, HIST1H3J, H3/j, H3FJ, histone cluster 1 H3 family member j, histone H3.1, H3 histone family, member J, histone 1, H3j, histone H3/j, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member J, H3 Histone Family, Member J, Histone Cluster 1, Histone 1, Histone H3/J, Histone H3.1, Histone H3/A, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/K, Histone H3/L, H3/J, H3FA, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FK, H3FL, MonoMethyl-Histone H3-R17, MonoMethylHistone H3-R17, MonoMethyl Histone H3-R17, H3R17me1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/j, Histone H3/k, Histone H3/l, H3R17,KO/KDantibody8356, HIST1H3J, H3/j, H3FJ, histone cluster 1 H3 family member j, histone H3.1, H3 histone family, member J, histone 1, H3j, histone H3/j, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member J, H3 Histone Family, Member J, Histone Cluster 1, Histone 1, Histone H3/J, Histone H3.1, Histone H3/A, Histone H [_Symbol] => H3C12 [_GeneID] => 8290/8350 [id] => 7586 [catid] => 413 [title] => MonoMethyl-Histone H3-R17 Rabbit pAb [url] => /catalog/A3151 [price] => 50 μL,1180,In Stock|100 μL,1860,In Stock|200 μL,2980,In Stock [CatalogNo] => A3151 [Synonyms] => H3/j; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FJ; H3C10; H3C11; HIST1H3J; MonoMethyl-Histone H3-R17 [description] => MonoMethyl-Histone H3-R17 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic monomethylated peptide around R17 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => MonoMethyl R17 [field_s10] => Unconjugated [field_s12] => [keywords] => 8356, HIST1H3J, H3/j, H3FJ, histone cluster 1 H3 family member j, histone H3.1, H3 histone family, member J, histone 1, H3j, histone H3/j, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member J, H3 Histone Family, Member J, Histone Cluster 1, Histone 1, Histone H3/J, Histone H3.1, Histone H3/A, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/K, Histone H3/L, H3/J, H3FA, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FK, H3FL, MonoMethyl-Histone H3-R17, MonoMethylHistone H3-R17, MonoMethyl Histone H3-R17, H3R17me1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/j, Histone H3/k, Histone H3/l, H3R17,KO/KD抗体8356, HIST1H3J, H3/j, H3FJ, histone cluster 1 H3 family member j, histone H3.1, H3 histone family, member J, histone 1, H3j, histone H3/j, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member J, H3 Histone Family, Member J, Histone Cluster 1, Histone 1, Histone H3/J, Histone H3.1, Histone H3/A, Histone H [field_l3] => APRKQ [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3151_Q6903(jia2)(Me)_WB_02.jpg?t=1715049883|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3151_DB_01.jpg?t=1715049883|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3151_G135(Me)_IHC_02.jpg?t=1715049883|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3151_G135(Me)_IHC_01.jpg?t=1715049883|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3151_G135(Me)_IHC_03.jpg?t=1715049883|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3151_Q6903(Me)_IF_01.jpg?t=1715049883|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3151_Q6903(Me)_IF_02.jpg?t=1715049883|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3151_Q6903(Me)_IF_03.jpg?t=1715049883 [Review] => 0 [Publication] => 0 [MoleculeName] => H3R17me1 [recommend] => 0 [status] => 1 [Symbol] => H3C12 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )