Array
(
[_title] => IFIH1 Rabbit pAb
[_Synonyms] => AGS7; Hlcd; MDA5; IMD95; MDA-5; RLR-2; IDDM19; SGMRT1; IFIH1
[_keywords] => 64135, sc-48031, Helicard, Helicase with 2 CARD domains, Hlcd, IDDM19, IFIH1, MDA 5, MDA5, RH116, RLR-2, AGS7, MDA-5, SGMRT1, interferon induced with helicase C domain 1, interferon-induced helicase C domain-containing protein 1, CADM-140 autoantigen, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, RIG-I-like receptor 2, RNA helicase-DEAD box protein 116, clinically amyopathic dermatomyositis autoantigen 140 kDa, helicard, helicase with 2 CARD domains, melanoma differentiation-associated gene 5, melanoma differentiation-associated protein 5, murabutide down-regulated protein, Q9BYX4, Interferon Induced With Helicase C Domain 1, Clinically Amyopathic Dermatomyositis Autoantigen 140 KDa, Melanoma Differentiation-Associated Protein 5, Melanoma Differentiation-Associated Gene 5, Murabutide Down-Regulated Protein, RNA Helicase-DEAD Box Protein 116, Helicase With 2 CARD Domains, RIG-I-Like Receptor 2, CADM-140 Autoantigen, Interferon-Induced Helicase C Domain-Containing Protein 1, Interferon-Induced With Helicase C D
[_Symbol] => IFIH1
[_GeneID] => 64135
[id] => 12242
[catid] => 131
[title] => IFIH1 Rabbit pAb
[url] => /catalog/A13645
[price] => 50 μL,1150,In Stock|100 μL,1870,In Stock|200 μL,2900,In Stock
[CatalogNo] => A13645
[Synonyms] => AGS7; Hlcd; MDA5; IMD95; MDA-5; RLR-2; IDDM19; SGMRT1; IFIH1
[description] => IFIH1 Rabbit pAb
[applications] => ELISA,WB,IHC-P,IF/ICC
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat
[field_s2] => 117kDa
[field_s3] => 140kDa
[field_s4] => Recombinant fusion protein containing a sequence corresponding to amino acids 1-205 of human IFIH1 (NP_071451.2).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
[field_s8] => yes
[field_s9] => Unmodified
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => 64135, sc-48031, Helicard, Helicase with 2 CARD domains, Hlcd, IDDM19, IFIH1, MDA 5, MDA5, RH116, RLR-2, AGS7, MDA-5, SGMRT1, interferon induced with helicase C domain 1, interferon-induced helicase C domain-containing protein 1, CADM-140 autoantigen, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, RIG-I-like receptor 2, RNA helicase-DEAD box protein 116, clinically amyopathic dermatomyositis autoantigen 140 kDa, helicard, helicase with 2 CARD domains, melanoma differentiation-associated gene 5, melanoma differentiation-associated protein 5, murabutide down-regulated protein, Q9BYX4, Interferon Induced With Helicase C Domain 1, Clinically Amyopathic Dermatomyositis Autoantigen 140 KDa, Melanoma Differentiation-Associated Protein 5, Melanoma Differentiation-Associated Gene 5, Murabutide Down-Regulated Protein, RNA Helicase-DEAD Box Protein 116, Helicase With 2 CARD Domains, RIG-I-Like Receptor 2, CADM-140 Autoantigen, Interferon-Induced Helicase C Domain-Containing Protein 1, Interferon-Induced With Helicase C D
[field_l3] => MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSES
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A13645_N12348-4_WB_01.jpg?t=1714972801|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A13645_N14499-4_IHC_01.jpg?t=1714972801|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A13645_N14499-4_IHC_02.jpg?t=1714972801|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A13645_N14499-4_IHC_03.jpg?t=1714972801|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A13645_N14499-4_IHC_04.jpg?t=1714972801|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A13645_N14499-4_IHC_05.jpg?t=1714972801|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A13645_N12347-4_IF_01.jpg?t=1714972801
[Review] => 0
[Publication] => 4
[MoleculeName] => IFIH1
[recommend] => 0
[status] => 1
[Symbol] => IFIH1
[posid] => 0
[GeneID] => Array
(
[0] => 64135
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 111
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => IFIH1 Rabbit pAb
[_Synonyms] => IFIH1; AGS7; Hlcd; IDDM19; MDA-5; MDA5; RLR-2; SGMRT1; interferon induced with helicase C domain 1
[_keywords] => sc-48031, Helicard, Helicase with 2 CARD domains, Hlcd, IDDM19, IFIH1, MDA 5, MDA5, RH116, RLR-2, AGS7, MDA-5, SGMRT1, interferon induced with helicase C domain 1, interferon-induced helicase C domain-containing protein 1, CADM-140 autoantigen, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, RIG-I-like receptor 2, RNA helicase-DEAD box protein 116, clinically amyopathic dermatomyositis autoantigen 140 kDa, helicard, helicase with 2 CARD domains, melanoma differentiation-associated gene 5, melanoma differentiation-associated protein 5, murabutide down-regulated protein, Q9BYX4, 64135, MGC133047, RLR2, RLR 2, sc48031, sc 48031,KO/KDantibodysc-48031, Helicard, Helicase with 2 CARD domains, Hlcd, IDDM19, IFIH1, MDA 5, MDA5, RH116, RLR-2, AGS7, MDA-5, SGMRT1, interferon induced with helicase C domain 1, interferon-induced helicase C domain-containing protein 1, CADM-140 autoantigen, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, RIG-I-like receptor 2, RNA helicase-DEAD box protein 116, clinically amyopathic dermatomyos
[_Symbol] => IFIH1
[_GeneID] => 64135
[id] => 43593
[catid] => 131
[title] => IFIH1 Rabbit pAb
[url] => /catalog/A24868
[price] => 50 μL,900,In Stock|100 μL,1500,In Stock|200 μL,2450,In Stock
[CatalogNo] => A24868
[Synonyms] => IFIH1; AGS7; Hlcd; IDDM19; MDA-5; MDA5; RLR-2; SGMRT1; interferon induced with helicase C domain 1
[description] => IFIH1 Rabbit pAb
[applications] => ELISA,WB
[Species] => Rabbit
[field_s1] => Human
[field_s2] => 25kDa/116kDa
[field_s3] => 140kDa
[field_s4] => Recombinant fusion protein containing a sequence corresponding to amino acids 277-490 of human IFIH1 (NP_071451.2).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => WB,1:500 - 1:1000
[field_s8] =>
[field_s9] => Unmodified
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => sc-48031, Helicard, Helicase with 2 CARD domains, Hlcd, IDDM19, IFIH1, MDA 5, MDA5, RH116, RLR-2, AGS7, MDA-5, SGMRT1, interferon induced with helicase C domain 1, interferon-induced helicase C domain-containing protein 1, CADM-140 autoantigen, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, RIG-I-like receptor 2, RNA helicase-DEAD box protein 116, clinically amyopathic dermatomyositis autoantigen 140 kDa, helicard, helicase with 2 CARD domains, melanoma differentiation-associated gene 5, melanoma differentiation-associated protein 5, murabutide down-regulated protein, Q9BYX4, 64135, MGC133047, RLR2, RLR 2, sc48031, sc 48031,KO/KD抗体sc-48031, Helicard, Helicase with 2 CARD domains, Hlcd, IDDM19, IFIH1, MDA 5, MDA5, RH116, RLR-2, AGS7, MDA-5, SGMRT1, interferon induced with helicase C domain 1, interferon-induced helicase C domain-containing protein 1, CADM-140 autoantigen, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, RIG-I-like receptor 2, RNA helicase-DEAD box protein 116, clinically amyopathic dermatomyos
[field_l3] => SNMGSDSGTMGSDSDEENVAARASPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENSLLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTAS
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A24868_N29304-4_WB_01.jpg?t=1715754065
[Review] => 0
[Publication] => 0
[MoleculeName] =>
[recommend] => 0
[status] => 1
[Symbol] => IFIH1
[posid] => 0
[GeneID] => Array
(
[0] => 64135
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 111
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
