我们为您找到 His 的 59 个相关产品结果。 您可以根据左侧筛选功能来找到您需要的产品。

Array ( [_title] => Symmetric DiMethyl-Histone H3-R8 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Symmetric DiMethyl-Histone H3-R8 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Symmetric DiMethyl-Histone H3-R8, Symmetric DiMethylHistone H3-R8, Symmetric DiMethyl Histone H3-R8, H3R8me2s, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3R8, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Symmetric DiMethyl-Histone H3-R8, Symmetric DiMethylHistone H3-R8, Symmetric DiMethyl Histone H3-R8, H3R8me2s, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/ [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8296 [catid] => 413 [title] => Symmetric DiMethyl-Histone H3-R8 Rabbit pAb [url] => /catalog/A2374 [price] => 50 μL,1180,In Stock|100 μL,1860,In Stock|200 μL,2980,In Stock [CatalogNo] => A2374 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Symmetric DiMethyl-Histone H3-R8 [description] => Symmetric DiMethyl-Histone H3-R8 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic symmetric dimethylated peptide around R8 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:100 - 1:500
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP-seq,1:20 - 1:50 [field_s8] => yes [field_s9] => Symmetric DiMethyl R8 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Symmetric DiMethyl-Histone H3-R8, Symmetric DiMethylHistone H3-R8, Symmetric DiMethyl Histone H3-R8, H3R8me2s, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3R8, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Symmetric DiMethyl-Histone H3-R8, Symmetric DiMethylHistone H3-R8, Symmetric DiMethyl Histone H3-R8, H3R8me2s, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/ [field_l3] => TARKS [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2374_G124(SMe)_WB_01.jpg?t=1713324216|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2374_DB_01.jpg?t=1713324216|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2374_IF_01.jpg?t=1713324216 [Review] => 1 [Publication] => 5 [MoleculeName] => H3R8me2s [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H4-K20 Rabbit pAb [_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; TriMethyl-Histone H4-K20 [_keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, TriMethyl-Histone H4-K20, TriMethylHistone H4-K20, TriMethyl Histone H4-K20, H4K20me3, H4K20,KO/KDantibody8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, [_Symbol] => H4C14 [_GeneID] => 8359 [id] => 8298 [catid] => 413 [title] => TriMethyl-Histone H4-K20 Rabbit pAb [url] => /catalog/A2372 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2372 [Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; TriMethyl-Histone H4-K20 [description] => TriMethyl-Histone H4-K20 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => 11kDa [field_s4] => A synthetic trimethylated peptide around K20 of human histone H4 (NP_003529.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:2000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => TriMethyl K20 [field_s10] => Unconjugated [field_s12] => [keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, TriMethyl-Histone H4-K20, TriMethylHistone H4-K20, TriMethyl Histone H4-K20, H4K20me3, H4K20,KO/KD抗体8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, [field_l3] => HRKVL [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2372_N23913-5(Me)_WB_01.jpg?t=1715048388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2372_E305(Me)(2)_DotBlot_01.jpg?t=1715048388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2372_N602(H)(Me)(AX)_IHC_01.jpg?t=1715048388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2372_N602(H)(Me)(AX)_IHC_02.jpg?t=1715048388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2372_IF_01.jpg?t=1715048388 [Review] => 1 [Publication] => 5 [MoleculeName] => H4K20me3 [recommend] => 0 [status] => 1 [Symbol] => H4C14 [posid] => 1 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DiMethyl-Histone H3-K36 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K36 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K36, DiMethylHistone H3-K36, DiMethyl Histone H3-K36, H3K36me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K36, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K36, DiMethylHistone H3-K36, DiMethyl Histone H3-K36, H3K36me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8307 [catid] => 413 [title] => DiMethyl-Histone H3-K36 Rabbit pAb [url] => /catalog/A2365 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2365 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K36 [description] => DiMethyl-Histone H3-K36 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic dimethylated peptide around K36 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100 [field_s8] => yes [field_s9] => DiMethyl K36 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K36, DiMethylHistone H3-K36, DiMethyl Histone H3-K36, H3K36me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K36, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K36, DiMethylHistone H3-K36, DiMethyl Histone H3-K36, H3K36me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone [field_l3] => GVKKP [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2365_N16210-5(Me)_WB_01.jpg?t=1715048307|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2365_N16210-5(Me)_WB_02.jpg?t=1715048307|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2365_DB_01.jpg?t=1715048307|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2365_N591(H)(Me)(AX)_IHC_01.jpg?t=1715048307|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2365_N591(H)(Me)(AX)_IHC_02.jpg?t=1715048307|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2365_N591(H)(Me)(AX)_IHC_03.jpg?t=1715048307|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2365_IF_01.jpg?t=1715048307|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2365_ChIP_01.jpg?t=1715048307 [Review] => 2 [Publication] => 4 [MoleculeName] => H3K36me2 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Asymmetric DiMethyl-Histone H3-R2 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Asymmetric DiMethyl-Histone H3-R2 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Asymmetric DiMethyl-Histone H3-R2, Asymmetric DiMethylHistone H3-R2, Asymmetric DiMethyl Histone H3-R2, H3R2me2a, H3R2, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Asymmetric DiMethyl-Histone H3-R2, Asymmetric DiMethylHistone H3-R2, Asymmetric DiMethyl Histone H3-R2, H3R2me2a, H3R2, marker, Chromatin, Chromatin marker,PTMantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 7582 [catid] => 413 [title] => Asymmetric DiMethyl-Histone H3-R2 Rabbit pAb [url] => /catalog/A3155 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A3155 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Asymmetric DiMethyl-Histone H3-R2 [description] => Asymmetric DiMethyl-Histone H3-R2 Rabbit pAb [applications] => ELISA,WB,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic asymmetric dimethylated peptide around R2 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:100 - 1:500
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => Asymmetric DiMethyl R2 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Asymmetric DiMethyl-Histone H3-R2, Asymmetric DiMethylHistone H3-R2, Asymmetric DiMethyl Histone H3-R2, H3R2me2a, H3R2, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Asymmetric DiMethyl-Histone H3-R2, Asymmetric DiMethylHistone H3-R2, Asymmetric DiMethyl Histone H3-R2, H3R2me2a, H3R2, marker, Chromatin, Chromatin marker,PTM抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone [field_l3] => MARTK [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3155_N5350-5(Me)_WB_02.jpg?t=1713324724|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3155_DB_01.jpg?t=1713324724|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3155_N15871-5(Me)_IF_01.jpg?t=1713324724|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3155_N15871-5(Me)_IF_02.jpg?t=1713324724|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3155_N15871-5(Me)_IF_03.jpg?t=1713324724|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3155_N15871-5(Me)_IF_04.jpg?t=1713324724 [Review] => 1 [Publication] => 4 [MoleculeName] => H3R2me2a [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DiMethyl-Histone H3-K79 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K79 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K79, DiMethylHistone H3-K79, DiMethyl Histone H3-K79, H3K79me2, MGC126886, MGC126888, H3K79, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K79, DiMethylHistone H3-K79, DiMethyl Histone H3-K79, H3K79me2, MGC126886, MGC126888, H3K79, marker, Chromatin, Chromatin marker,PTMantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8304 [catid] => 413 [title] => DiMethyl-Histone H3-K79 Rabbit pAb [url] => /catalog/A2368 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2368 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K79 [description] => DiMethyl-Histone H3-K79 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC,IP,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic dimethylated peptide around K79 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:100
IF/ICC,1:50 - 1:200
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:50 - 1:200 [field_s8] => yes [field_s9] => DiMethyl K79 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K79, DiMethylHistone H3-K79, DiMethyl Histone H3-K79, H3K79me2, MGC126886, MGC126888, H3K79, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K79, DiMethylHistone H3-K79, DiMethyl Histone H3-K79, H3K79me2, MGC126886, MGC126888, H3K79, marker, Chromatin, Chromatin marker,PTM抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member [field_l3] => DFKTD [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2368_G181(Me)_ChIP-seq_01.jpg?t=1715048334|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2368_N598(H)(Me)(AX)_WB_01.jpg?t=1715048334|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2368_G180(Me)_DB_01.jpg?t=1715048334|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2368_N598(H)(Me)(A)_IHC_01.jpg?t=1715048334|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2368_N598(H)(Me)(A)_IHC_02.jpg?t=1715048334|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2368_N598(H)(Me)(A)_IHC_03.jpg?t=1715048334|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2368_IF_01.jpg?t=1715048334|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2368_G181(Me)_IP_01.jpg?t=1715048334|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2368_G181(Me)_ChIP_01.jpg?t=1715048334 [Review] => 2 [Publication] => 3 [MoleculeName] => H3K79me2 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Asymmetric DiMethyl-Histone H4-R3 Rabbit pAb [_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Asymmetric DiMethyl-Histone H4-R3 [_keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, Asymmetric DiMethyl-Histone H4-R3, Asymmetric DiMethylHistone H4-R3, Asymmetric DiMethyl Histone H4-R3, H4R3me2a, H3t, H3.4, H3/g, H3FT, H4R3,KO/KDantibody8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, [_Symbol] => H4C14 [_GeneID] => 8359 [id] => 8285 [catid] => 413 [title] => Asymmetric DiMethyl-Histone H4-R3 Rabbit pAb [url] => /catalog/A2376 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2376 [Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Asymmetric DiMethyl-Histone H4-R3 [description] => Asymmetric DiMethyl-Histone H4-R3 Rabbit pAb [applications] => ELISA,WB,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => 11kDa [field_s4] => A synthetic asymmetric dimethylated peptide around R3 of human histone H4 (NP_003539.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:2000
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => Asymmetric DiMethyl R3 [field_s10] => Unconjugated [field_s12] => [keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, Asymmetric DiMethyl-Histone H4-R3, Asymmetric DiMethylHistone H4-R3, Asymmetric DiMethyl Histone H4-R3, H4R3me2a, H3t, H3.4, H3/g, H3FT, H4R3,KO/KD抗体8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, [field_l3] => SGRGK [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2376_K49(Me)_WB_01.jpg?t=1711176903|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2376_DB_01.jpg?t=1711176903|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2376_IF_01.jpg?t=1711176903 [Review] => 1 [Publication] => 3 [MoleculeName] => H4R3me2a [recommend] => 0 [status] => 1 [Symbol] => H4C14 [posid] => 1 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DiMethyl-Histone H3-K27 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K27 [_keywords] => [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8312 [catid] => 413 [title] => DiMethyl-Histone H3-K27 Rabbit pAb [url] => /catalog/A2362 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2362 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K27 [description] => DiMethyl-Histone H3-K27 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100 [field_s8] => yes [field_s9] => DiMethyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2362_aN647(8-10)(Me)(2)_WB_01.jpg?t=1713324069|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2362_N648-4(me)_DotBlot_01.jpg?t=1713324069|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2362_N28788-5(Me)_IHC_01.jpg?t=1713324069|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2362_N28788-5(Me)_IHC_02.jpg?t=1713324069|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2362_N28788-5(Me)_IHC_03.jpg?t=1713324069|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2362_N15866-5(Me)_IF_01.jpg?t=1713324069|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2362_ChIP_01.jpg?t=1713324069 [Review] => 3 [Publication] => 2 [MoleculeName] => H3K27me2 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DiMethyl-Histone H4-K20 Rabbit pAb [_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; DiMethyl-Histone H4-K20 [_keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, DiMethyl-Histone H4-K20, DiMethylHistone H4-K20, DiMethyl Histone H4-K20, H4K20me2, H4K20,KO/KDantibody8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/ [_Symbol] => H4C14 [_GeneID] => 8359 [id] => 8300 [catid] => 413 [title] => DiMethyl-Histone H4-K20 Rabbit pAb [url] => /catalog/A2371 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2371 [Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; DiMethyl-Histone H4-K20 [description] => DiMethyl-Histone H4-K20 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => 11kDa [field_s4] => A synthetic dimethylated peptide around K20 of human histone H4 (NP_003529.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => DiMethyl K20 [field_s10] => Unconjugated [field_s12] => [keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, DiMethyl-Histone H4-K20, DiMethylHistone H4-K20, DiMethyl Histone H4-K20, H4K20me2, H4K20,KO/KD抗体8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/ [field_l3] => HRKVL [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2371_N5354-5(Me)_WB_02.jpg?t=1715048378|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2371_DB_01.jpg?t=1715048378|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2371_N650(H)(Me)(A)_IHC_01.jpg?t=1715048378|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2371_N650(H)(Me)(A)_IHC_02.jpg?t=1715048378|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2371_IF_01.jpg?t=1715048378 [Review] => 2 [Publication] => 2 [MoleculeName] => H4K20me2 [recommend] => 0 [status] => 1 [Symbol] => H4C14 [posid] => 1 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H3-K79 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K79 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K79, MonoMethylHistone H3-K79, MonoMethyl Histone H3-K79, H3K79me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K79, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K79, MonoMethylHistone H3-K79, MonoMethyl Histone H3-K79, H3K79me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3 [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8305 [catid] => 413 [title] => MonoMethyl-Histone H3-K79 Rabbit pAb [url] => /catalog/A2367 [price] => 50 μL,1180,In Stock|100 μL,1860,In Stock|200 μL,2980,In Stock [CatalogNo] => A2367 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K79 [description] => MonoMethyl-Histone H3-K79 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic monomethylated peptide around K79 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,6μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100 [field_s8] => yes [field_s9] => MonoMethyl K79 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K79, MonoMethylHistone H3-K79, MonoMethyl Histone H3-K79, H3K79me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K79, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K79, MonoMethylHistone H3-K79, MonoMethyl Histone H3-K79, H3K79me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3 [field_l3] => DFKTD [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2367_N597-4(me)_WB_01.jpg?t=1713324131|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2367_G178(Me)_DB_01.jpg?t=1713324131|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2367_IF_01.jpg?t=1713324131|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2367_G178(Me)PuFt_ChIP_01.jpg?t=1713324131 [Review] => 0 [Publication] => 3 [MoleculeName] => H3K79me1 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Symmetric DiMethyl-Histone H3-R2 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Symmetric DiMethyl-Histone H3-R2 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Symmetric DiMethyl-Histone H3-R2, Symmetric DiMethylHistone H3-R2, Symmetric DiMethyl Histone H3-R2, H3R2me2s, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3R2, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Symmetric DiMethyl-Histone H3-R2, Symmetric DiMethylHistone H3-R2, Symmetric DiMethyl Histone H3-R2, H3R2me2s, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/ [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8302 [catid] => 413 [title] => Symmetric DiMethyl-Histone H3-R2 Rabbit pAb [url] => /catalog/A2373 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2373 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Symmetric DiMethyl-Histone H3-R2 [description] => Symmetric DiMethyl-Histone H3-R2 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic asymmetric dimethylated peptide around R2 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP-seq,1:20 - 1:100 [field_s8] => yes [field_s9] => Symmetric DiMethyl R2 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Symmetric DiMethyl-Histone H3-R2, Symmetric DiMethylHistone H3-R2, Symmetric DiMethyl Histone H3-R2, H3R2me2s, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3R2, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Symmetric DiMethyl-Histone H3-R2, Symmetric DiMethylHistone H3-R2, Symmetric DiMethyl Histone H3-R2, H3R2me2s, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/ [field_l3] => MARTK [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2373_N14117-5(Me)_WB_01.jpg?t=1715333713|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2373_DB_01.jpg?t=1715333713|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2373_G109(Me)_IHC_02.jpg?t=1715333713|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2373_G109(Me)_IHC_01.jpg?t=1715333713|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2373_G109(Me)_IHC_03.jpg?t=1715333713|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2373_G110(Me)(T)_IF_01.jpg?t=1715333713|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2373_G110(Me)(T)_IF_02.jpg?t=1715333713 [Review] => 0 [Publication] => 2 [MoleculeName] => H3R2me2s [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Asymmetric DiMethyl-Histone H3-R26 Rabbit pAb [_Synonyms] => H3/j; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FJ; H3C10; H3C11; HIST1H3J; Asymmetric DiMethyl-Histone H3-R26 [_keywords] => 8356, HIST1H3J, H3/j, H3FJ, histone cluster 1 H3 family member j, histone H3.1, H3 histone family, member J, histone 1, H3j, histone H3/j, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member J, H3 Histone Family, Member J, Histone Cluster 1, Histone 1, Histone H3/J, Histone H3.1, Histone H3/A, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/K, Histone H3/L, H3/J, H3FA, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FK, H3FL, Asymmetric DiMethyl-Histone H3-R26, Asymmetric DiMethylHistone H3-R26, Asymmetric DiMethyl Histone H3-R26, H3R26me2a, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/j, Histone H3/k, Histone H3/l, H3R26,KO/KDantibody8356, HIST1H3J, H3/j, H3FJ, histone cluster 1 H3 family member j, histone H3.1, H3 histone family, member J, histone 1, H3j, histone H3/j, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member J, H3 Histone Family, Member J, Histone Cluster 1, Histone 1, Histone H3/J, Histone H [_Symbol] => H3C12 [_GeneID] => 8290/8350 [id] => 8297 [catid] => 413 [title] => Asymmetric DiMethyl-Histone H3-R26 Rabbit pAb [url] => /catalog/A2375 [price] => 50 μL,1180,In Stock|100 μL,1860,In Stock|200 μL,2980,In Stock [CatalogNo] => A2375 [Synonyms] => H3/j; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FJ; H3C10; H3C11; HIST1H3J; Asymmetric DiMethyl-Histone H3-R26 [description] => Asymmetric DiMethyl-Histone H3-R26 Rabbit pAb [applications] => ELISA,WB,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 14kDa [field_s4] => A synthetic asymmetric dimethylated peptide around R26 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => Asymmetric DiMethyl R26 [field_s10] => Unconjugated [field_s12] => [keywords] => 8356, HIST1H3J, H3/j, H3FJ, histone cluster 1 H3 family member j, histone H3.1, H3 histone family, member J, histone 1, H3j, histone H3/j, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member J, H3 Histone Family, Member J, Histone Cluster 1, Histone 1, Histone H3/J, Histone H3.1, Histone H3/A, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/K, Histone H3/L, H3/J, H3FA, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FK, H3FL, Asymmetric DiMethyl-Histone H3-R26, Asymmetric DiMethylHistone H3-R26, Asymmetric DiMethyl Histone H3-R26, H3R26me2a, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/j, Histone H3/k, Histone H3/l, H3R26,KO/KD抗体8356, HIST1H3J, H3/j, H3FJ, histone cluster 1 H3 family member j, histone H3.1, H3 histone family, member J, histone 1, H3j, histone H3/j, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member J, H3 Histone Family, Member J, Histone Cluster 1, Histone 1, Histone H3/J, Histone H [field_l3] => AARKS [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2375_K45(Me)_WB_01.jpg?t=1713324224|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2375_IF_01.jpg?t=1713324224 [Review] => 0 [Publication] => 1 [MoleculeName] => H3R26me2a [recommend] => 0 [status] => 1 [Symbol] => H3C12 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H3-K36 Rabbit pAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K36 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, marker, Chromatin, Chromatin marker, MonoMethyl-Histone H3-K36,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/ [_Symbol] => H3C1 [_GeneID] => 8290/8350 [id] => 30589 [catid] => 413 [title] => MonoMethyl-Histone H3-K36 Rabbit pAb [url] => /catalog/A20566 [price] => 50 μL,1180,In Stock|100 μL,1860,In Stock|200 μL,2980,In Stock [CatalogNo] => A20566 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K36 [description] => MonoMethyl-Histone H3-K36 Rabbit pAb [applications] => ELISA,WB,IF/ICC,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic monomethylated peptide around K36 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IF/ICC,1:50 - 1:200
ChIP-seq,1:20 - 1:100 [field_s8] => [field_s9] => MonoMethyl K36 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, marker, Chromatin, Chromatin marker, MonoMethyl-Histone H3-K36,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/ [field_l3] => GGVKK [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20566_N14129-5(Me)_WB_01.jpg?t=1713322942 [Review] => 0 [Publication] => 1 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H3-R2 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-R2 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-R2, H3R2me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3R2, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-R2, H3R2me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3R2, marker, Chromatin [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 7583 [catid] => 413 [title] => MonoMethyl-Histone H3-R2 Rabbit pAb [url] => /catalog/A3154 [price] => 50 μL,1180,In Stock|100 μL,1860,In Stock|200 μL,2980,In Stock [CatalogNo] => A3154 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-R2 [description] => MonoMethyl-Histone H3-R2 Rabbit pAb [applications] => ELISA,WB,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic monomethylated peptide around R2 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => MonoMethyl R2 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-R2, H3R2me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3R2, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-R2, H3R2me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3R2, marker, Chromatin [field_l3] => MARTK [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3154_E1485(SMe)_WB_01.jpg?t=1713324721|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3154_E1483(Me)_DB_01.jpg?t=1713324721|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3154_IF_01.jpg?t=1713324721 [Review] => 0 [Publication] => 1 [MoleculeName] => H3R2me1 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H3-R26 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-R26 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-R26, MonoMethylHistone H3-R26, MonoMethyl Histone H3-R26, H3R26me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3R26, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-R26, MonoMethylHistone H3-R26, MonoMethyl Histone H3-R26, H3R26me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3 [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 7571 [catid] => 413 [title] => MonoMethyl-Histone H3-R26 Rabbit pAb [url] => /catalog/A3163 [price] => 50 μL,1180,In Stock|100 μL,1860,In Stock|200 μL,2980,In Stock [CatalogNo] => A3163 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-R26 [description] => MonoMethyl-Histone H3-R26 Rabbit pAb [applications] => ELISA,WB,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic monomethylated peptide around R26 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:2000
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => MonoMethyl R26 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-R26, MonoMethylHistone H3-R26, MonoMethyl Histone H3-R26, H3R26me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3R26, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-R26, MonoMethylHistone H3-R26, MonoMethyl Histone H3-R26, H3R26me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3 [field_l3] => AARKS [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3163_WB_01.jpg?t=1713324798|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3163_DB_01.jpg?t=1713324798|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3163_IF_01.jpg?t=1713324798 [Review] => 0 [Publication] => 1 [MoleculeName] => H3R26me1 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Asymmetric DiMethyl-Histone H3-R17 [_keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, Asymmetric DiMethyl R17, H3R17, marker, Chromatin, Chromatin marker, Asymmetric DiMethyl-Histone H3-R17,PTMantibody8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone [_Symbol] => H3C1 [_GeneID] => 8290/8350 [id] => 19595 [catid] => 413 [title] => Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb [url] => /catalog/A17899 [price] => 50 μL,1260,In Stock|100 μL,2000,In Stock|200 μL,3260,In Stock [CatalogNo] => A17899 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Asymmetric DiMethyl-Histone H3-R17 [description] => Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic asymmetric dimethylated peptide around R17 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200 [field_s8] => [field_s9] => Asymmetric DiMethyl R17 [field_s10] => Unconjugated [field_s12] => [keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, Asymmetric DiMethyl R17, H3R17, marker, Chromatin, Chromatin marker, Asymmetric DiMethyl-Histone H3-R17,PTM抗体8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone [field_l3] => APRKQ [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17899_N2527(6-9)(Me)_WB_02.jpg?t=1715134187|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17899_N2529-5(Me)_IHC_01.jpg?t=1715134187|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17899_N2527-5(Me)_IF_01.jpg?t=1715134187 [Review] => 0 [Publication] => 0 [MoleculeName] => H3R17me2a [recommend] => 0 [status] => 1 [Symbol] => H3C1 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )