Array
(
[_title] => Histone H3 Rabbit pAb
[_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Histone H3
[_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, marker, Chromatin, Chromatin marker,PTMantibody
[_Symbol] => H3-4
[_GeneID] => 8290/8350
[id] => 8329
[catid] => 131
[title] => Histone H3 Rabbit pAb
[url] => /catalog/A2348
[price] => 50 μL,1150,In Stock|100 μL,1870,In Stock|200 μL,2900,In Stock
[CatalogNo] => A2348
[Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Histone H3
[description] => Histone H3 Rabbit pAb
[applications] => ELISA,WB,IHC-P,IF/ICC,IP,ChIP
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 16kDa
[field_s3] => 17kDa
[field_s4] => A synthetic peptide corresponding to a sequence within amino acids 36-136 of human HIST3H3 (NP_003520.1).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => WB,1:2000 - 1:10000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
ChIP,3μg antibody for 5μg-10μg of Chromatin
[field_s8] => yes
[field_s9] => Unmodified
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, marker, Chromatin, Chromatin marker,PTM抗体
[field_l3] => VKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_aG307-12_WB_01.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N342_IHC_01.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N342_IHC_02.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N342_IHC_03.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N342_IHC_04.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_aG307-12_IF_01.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_aG307-12_IF_02.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N13848-6_IP_01.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N13847-6_IP_01.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N13847-6_ChIP_01.jpg?t=1715047861
[Review] => 5
[Publication] => 166
[MoleculeName] => HIST3H3
[recommend] => 0
[status] => 1
[Symbol] => H3-4
[posid] => 0
[GeneID] => Array
(
[0] => 8290
[1] => 8350
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 111
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => Histone H3 Rabbit pAb
[_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Histone H3
[_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, marker, Chromatin, Chromatin marker,PTMantibody
[_Symbol] => H3-4
[_GeneID] => 8290/8350
[id] => 8325
[catid] => 131
[title] => Histone H3 Rabbit pAb
[url] => /catalog/A2352
[price] => 50 μL,1150,In Stock|100 μL,1870,In Stock|200 μL,2900,In Stock
[CatalogNo] => A2352
[Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Histone H3
[description] => Histone H3 Rabbit pAb
[applications] => ELISA,WB,IHC-P,IP,ChIP
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 16kDa
[field_s3] => 17kDa
[field_s4] => A synthetic peptide corresponding to a sequence within amino acids 50-136 of human HIST3H3 (NP_003484.1).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => WB,1:2000 - 1:10000
IHC-P,1:50 - 1:200
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
ChIP,5μg antibody for 5μg-10μg of Chromatin
[field_s8] => yes
[field_s9] => Unmodified
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, marker, Chromatin, Chromatin marker,PTM抗体
[field_l3] => REIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2352_G106_WB_01.jpg?t=1715048026|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2352_G306-6_IHC_01.jpg?t=1715048026|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2352_G306-6_IHC_02.jpg?t=1715048026|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2352_G306-6_IHC_03.jpg?t=1715048026|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2352_Q87_IP_01.jpg?t=1715048026|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2352_G309-9_ChIP_01.jpg?t=1715048026
[Review] => 1
[Publication] => 5
[MoleculeName] => HIST3H3
[recommend] => 0
[status] => 1
[Symbol] => H3-4
[posid] => 0
[GeneID] => Array
(
[0] => 8290
[1] => 8350
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 111
[datasheet] =>
[validation] => 0
[status_cn] => 1
)