我们为您找到 His 的 59 个相关产品结果。 您可以根据左侧筛选功能来找到您需要的产品。

Array ( [_title] => TriMethyl-Histone H3-K27 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, H [_Symbol] => H3C1/H3-4 [_GeneID] => 8290/8350 [id] => 33206 [catid] => 413 [title] => TriMethyl-Histone H3-K27 Rabbit mAb [url] => /catalog/A22006 [price] => 50 μL,1600,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22006 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [description] => TriMethyl-Histone H3-K27 Rabbit mAb [applications] => ELISA,DB,WB,IF/ICC,IP,ChIP,CUT&Tag [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kd [field_s4] => A synthetic trimethylated peptide around K27 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:2000 - 1:20000
WB,1:10000 - 1:160000
IF/ICC,1:500 - 1:1000
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
ChIP,5μg antibody for 5μg-10μg of Chromatin
CUT&Tag, 10⁵ cells /1 μg [field_s8] => [field_s9] => TriMethyl K27 [field_s10] => [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, H [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22006_ARC54169-02_cut-tag_01.jpg?t=1713255154|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22006_ARC54169-02_cut-tag_02.jpg?t=1713255154|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22006_ARC54169-01_WB_01.jpg?t=1713255154|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22006_ARC54169-01_IF_01.jpg?t=1713255154|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22006_ARC54169-01_IF_02.jpg?t=1713255154|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22006_ARC54169-02_IP_01.jpg?t=1713255154|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22006_ARC54169-01_ChIP_01.jpg?t=1713255154 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1/H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K27 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, H [_Symbol] => H3C1/H3-4 [_GeneID] => 8290/8350 [id] => 34064 [catid] => 413 [title] => TriMethyl-Histone H3-K27 Rabbit mAb [url] => /catalog/A22396 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22396 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [description] => TriMethyl-Histone H3-K27 Rabbit mAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP,CUT&Tag [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic trimethylated peptide around K27 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:10000 - 1:160000
IHC-P,1:500 - 1:1000
IF/ICC,1:500 - 1:1000
ChIP,5μg antibody for 5μg-10μg of Chromatin
CUT&Tag, 10⁵ cells /1 μg [field_s8] => [field_s9] => TriMethyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, H [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22396_ARC54167-01_ChIP-seq_01.jpg?t=1715046315|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22396_ARC54167-01_WB_01.jpg?t=1715046315|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22396_ARC54167-01_IHC_01.jpg?t=1715046315|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22396_ARC54167-01_IHC_02.jpg?t=1715046315|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22396_ARC54167-01_IF_01.jpg?t=1715046315|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22396_ARC54167-01_ChIP_01.jpg?t=1715046315 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1/H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K4 Rabbit mAb [_Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 33672 [catid] => 413 [title] => TriMethyl-Histone H3-K4 Rabbit mAb [url] => /catalog/A22226 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22226 [Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [description] => TriMethyl-Histone H3-K4 Rabbit mAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP,DB [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic trimethylated peptide around K4 of human TriMethyl-Histone H3-K4 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:10000 - 1:40000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
DB,1:10000 - 1:40000 [field_s8] => [field_s9] => TriMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [field_l3] => ARTKQ [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_WB_01.jpg?t=1718876957|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_DotBlot_01.jpg?t=1718876957|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_IHC_01.jpg?t=1718876957|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_IHC_02.jpg?t=1718876957|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_IHC_03.jpg?t=1718876957|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_IHC_04.jpg?t=1718876957|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_IF_01.jpg?t=1718876957|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_IF_02.jpg?t=1718876957|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_IF_03.jpg?t=1718876957|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_ChIP_01.jpg?t=1718876957 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K4 Rabbit mAb [_Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 33673 [catid] => 413 [title] => TriMethyl-Histone H3-K4 Rabbit mAb [url] => /catalog/A22224 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22224 [Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [description] => TriMethyl-Histone H3-K4 Rabbit mAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => Refer to figures [field_s4] => A synthetic trimethylated peptide around K4 of human TriMethyl-Histone H3-K4 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:10000 - 1:30000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => TriMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [field_l3] => ARTKQ [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22224_ARC55088-01_WB_01.jpg?t=1715045851|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22224_ARC55088-01_IHC_01.jpg?t=1715045851|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22224_ARC55088-01_IHC_02.jpg?t=1715045851|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22224_ARC55088-01_IHC_03.jpg?t=1715045851|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22224_ARC55088-01_IF_01.jpg?t=1715045851|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22224_ARC55088-01_IF_02.jpg?t=1715045851|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22224_ARC55088-01_IF_03.jpg?t=1715045851|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22224_ARC55088-01_ChIP_01.jpg?t=1715045851 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K9 Rabbit mAb [_Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K9 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 15095 [catid] => 413 [title] => TriMethyl-Histone H3-K9 Rabbit mAb [url] => /catalog/A22295 [price] => 50 μL,1600,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22295 [Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K9 [description] => TriMethyl-Histone H3-K9 Rabbit mAb [applications] => ELISA,WB,IF/ICC,ChIP,ChIP-seq,DB,CUT&Tag [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic trimethylated peptide around K9 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:2000 - 1:20000
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100
DB,1:2000 - 1:20000
CUT&Tag,10⁵ cells /1 μg [field_s8] => [field_s9] => TriMethyl K9 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22295_ARC54898-01_ChIP-seq_01.jpg?t=1713323603|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22295_ARC54898-01_cut-tag_01.jpg?t=1713323603|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22295_ARC54898-01_WB_01.jpg?t=1713323603|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22295_ARC54898-01_DotBlot_01.jpg?t=1713323603|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22295_ARC54898-01_IF_01.jpg?t=1713323603|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22295_ARC54898-01_ChIP_01.jpg?t=1713323603 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H3-K4 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K4 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histo [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8321 [catid] => 413 [title] => MonoMethyl-Histone H3-K4 Rabbit pAb [url] => /catalog/A2355 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2355 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K4 [description] => MonoMethyl-Histone H3-K4 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic monomethylated peptide around K4 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100 [field_s8] => yes [field_s9] => MonoMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histo [field_l3] => RTKQT [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_aN551(14-15)(Me)_WB_01.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_E451(Me)(2)_DB_01.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_MP50519-03_IHC_01.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_MP50519-03_IHC_02.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_MP50519-03_IHC_03.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_N551-9(Me)_IF_01.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_N10017(Me)_IF_01.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_N10017(Me)_IF_02.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_N10017(Me)_IF_03.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_N20433-5(Me)_IF_01.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_N20433-5(Me)_IF_02.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_E450(Me)(2)_ChIP_01.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_N17149-5(Me)_ChIP_01.jpg?t=1713323963 [Review] => 3 [Publication] => 37 [MoleculeName] => H3K4me1 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DiMethyl-Histone H3-K4 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K4 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 452 [catid] => 413 [title] => DiMethyl-Histone H3-K4 Rabbit pAb [url] => /catalog/A2356 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2356 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K4 [description] => DiMethyl-Histone H3-K4 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5.5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:50 - 1:200 [field_s8] => yes [field_s9] => DiMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2356_N10019-5(Me)_WB_04.jpg?t=1718946746|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2356_E455(Me)_DB_01.jpg?t=1718946746|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2356_E457(Me)(2)_IHC_01.jpg?t=1718946746|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2356_E457(Me)(2)_IHC_02.jpg?t=1718946746|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2356_E457(Me)(2)_IHC_03.jpg?t=1718946746|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2356_N16084-5(Me)_IF_01.jpg?t=1718946746|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2356_N557(H)(Me))_ChIP_01.jpg?t=1718946746 [Review] => 2 [Publication] => 24 [MoleculeName] => H3K4me2 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K36 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K36 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K36, TriMethylHistone H3-K36, TriMethyl Histone H3-K36, H3K36me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K36, marker, Chromatin, Chromatin marker [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8306 [catid] => 413 [title] => TriMethyl-Histone H3-K36 Rabbit pAb [url] => /catalog/A2366 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2366 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K36 [description] => TriMethyl-Histone H3-K36 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100 [field_s8] => yes [field_s9] => TriMethyl K36 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K36, TriMethylHistone H3-K36, TriMethyl Histone H3-K36, H3K36me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K36, marker, Chromatin, Chromatin marker [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2366_N5370(15-16-17)(Me)_WB_01.jpg?t=1718946758|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2366_E485(Me)_DB_01.jpg?t=1718946758|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2366_N5368(Me)_IHC_01.jpg?t=1718946758|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2366_N5368(Me)_IHC_02.jpg?t=1718946758|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2366_N5368(Me)_IHC_03.jpg?t=1718946758|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2366_N5368(Me)_IHC_04.jpg?t=1718946758|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2366_IF_01.jpg?t=1718946758|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2366_N590(15-18)(Me)_ChIP_01.jpg?t=1718946758|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2366_N590(12-14)(Me)_ChIP_01.jpg?t=1718946758|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2366_MP50050-01_ChIP_02.jpg?t=1718946758 [Review] => 3 [Publication] => 16 [MoleculeName] => H3K36me3 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K27 Mouse mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Hi [_Symbol] => H3-4 [_GeneID] => 8350 [id] => 9580 [catid] => 413 [title] => TriMethyl-Histone H3-K27 Mouse mAb [url] => /catalog/A16199 [price] => 50 μL,1800,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A16199 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [description] => TriMethyl-Histone H3-K27 Mouse mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,CUT&Tag [Species] => Mouse [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic methylated peptide corresponding to residues surrounding K27 of human histone H3 [field_s5] => Human [field_s6] => IgG1,kappa [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
CUT&Tag, 10⁵ cells /1 μg [field_s8] => yes [field_s9] => TriMethyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Hi [field_l3] => [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A16199_AMC0477-01-1_ChIP-seq_01.jpg?t=1714985007|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A16199_AMC0017-02-1_WB_01.jpg?t=1714985007|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A16199_AMC0017-01-1_DotBlot_01.jpg?t=1714985007|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A16199_AMC0017-01-1_IHC_01.jpg?t=1714985007|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A16199_AMC0017-01-1_IHC_02.jpg?t=1714985007|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A16199_AMC0017-01-1_IHC_03.jpg?t=1714985007|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A16199_AMC0017-01-1_IF_01.jpg?t=1714985007|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A16199_AMC0017-01-1_IF_02.jpg?t=1714985007|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A16199_AMC0017-01-1_IF_03.jpg?t=1714985007|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A16199_AMC0477-01-1_ChIP_01.jpg?t=1714985007 [Review] => 0 [Publication] => 12 [MoleculeName] => H3K27me3 [recommend] => 1 [status] => 1 [Symbol] => H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H3-K9 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K9 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histo [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8315 [catid] => 413 [title] => MonoMethyl-Histone H3-K9 Rabbit pAb [url] => /catalog/A2358 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2358 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K9 [description] => MonoMethyl-Histone H3-K9 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 14kDa [field_s4] => A synthetic monomethylated peptide around K9 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100 [field_s8] => yes [field_s9] => MonoMethyl K9 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histo [field_l3] => ARKST [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_E257(Me)PuFt_WB_01.jpg?t=1715048234|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_E257(Me)_DB_01.jpg?t=1715048234|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_N16085-5(Me)_IHC_01.jpg?t=1715048234|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_N16085-5(Me)_IHC_02.jpg?t=1715048234|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_IF_01.jpg?t=1715048234|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_E257(Me)_IF_01.jpg?t=1715048234|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_E257(Me)_IF_02.jpg?t=1715048234|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_E257(Me)_IF_03.jpg?t=1715048234|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_N13852-6(Me)_ChIP_01.jpg?t=1715048234|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_E256(Me)_ChIP_01.jpg?t=1715048234 [Review] => 1 [Publication] => 11 [MoleculeName] => H3K9me1 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb [_Synonyms] => H3/j; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FJ; H3C10; H3C11; HIST1H3J; Asymmetric DiMethyl-Histone H3-R17 [_keywords] => 8356, HIST1H3J, H3/j, H3FJ, histone cluster 1 H3 family member j, histone H3.1, H3 histone family, member J, histone 1, H3j, histone H3/j, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member J, H3 Histone Family, Member J, Histone Cluster 1, Histone 1, Histone H3/J, Histone H3.1, Histone H3/A, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/K, Histone H3/L, H3/J, H3FA, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FK, H3FL, Asymmetric DiMethyl-Histone H3-R17, Asymmetric DiMethylHistone H3-R17, Asymmetric DiMethyl Histone H3-R17, H3R17me2a, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/j, Histone H3/k, Histone H3/l, H3R17,KO/KDantibody8356, HIST1H3J, H3/j, H3FJ, histone cluster 1 H3 family member j, histone H3.1, H3 histone family, member J, histone 1, H3j, histone H3/j, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member J, H3 Histone Family, Member J, Histone Cluster 1, Histone 1, Histone H3/J, Histone H [_Symbol] => H3C12 [_GeneID] => 8290/8350 [id] => 8288 [catid] => 413 [title] => Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb [url] => /catalog/A2421 [price] => 50 μL,1260,In Stock|100 μL,2000,In Stock|200 μL,3260,In Stock [CatalogNo] => A2421 [Synonyms] => H3/j; H3C1; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FJ; H3C10; H3C11; HIST1H3J; Asymmetric DiMethyl-Histone H3-R17 [description] => Asymmetric DiMethyl-Histone H3-R17 Rabbit pAb [applications] => ELISA,WB,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => Asymmetric DiMethyl R17 [field_s10] => Unconjugated [field_s12] => [keywords] => 8356, HIST1H3J, H3/j, H3FJ, histone cluster 1 H3 family member j, histone H3.1, H3 histone family, member J, histone 1, H3j, histone H3/j, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member J, H3 Histone Family, Member J, Histone Cluster 1, Histone 1, Histone H3/J, Histone H3.1, Histone H3/A, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/K, Histone H3/L, H3/J, H3FA, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FK, H3FL, Asymmetric DiMethyl-Histone H3-R17, Asymmetric DiMethylHistone H3-R17, Asymmetric DiMethyl Histone H3-R17, H3R17me2a, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/j, Histone H3/k, Histone H3/l, H3R17,KO/KD抗体8356, HIST1H3J, H3/j, H3FJ, histone cluster 1 H3 family member j, histone H3.1, H3 histone family, member J, histone 1, H3j, histone H3/j, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member J, H3 Histone Family, Member J, Histone Cluster 1, Histone 1, Histone H3/J, Histone H [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2421_N15381-5(Me)_WB_01.jpg?t=1713324351|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2421_DB_01.jpg?t=1713324351|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2421_IF_01.jpg?t=1713324351|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2421_G143(Me)_IF_01.jpg?t=1713324351 [Review] => 1 [Publication] => 7 [MoleculeName] => H3R17me2a [recommend] => 0 [status] => 1 [Symbol] => H3C12 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H3-K36 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K36 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K36, MonoMethylHistone H3-K36, MonoMethyl Histone H3-K36, H3K36me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K36, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K36, MonoMethylHistone H3-K36, MonoMethyl Histone H3-K36, H3K36me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3 [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8308 [catid] => 413 [title] => MonoMethyl-Histone H3-K36 Rabbit pAb [url] => /catalog/A2364 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2364 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K36 [description] => MonoMethyl-Histone H3-K36 Rabbit pAb [applications] => ELISA,WB,IF/ICC,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IF/ICC,1:50 - 1:200
ChIP,6.5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100 [field_s8] => yes [field_s9] => MonoMethyl K36 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K36, MonoMethylHistone H3-K36, MonoMethyl Histone H3-K36, H3K36me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K36, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K36, MonoMethylHistone H3-K36, MonoMethyl Histone H3-K36, H3K36me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3 [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2364_N5256(7-9)(Me)_WB_02.jpg?t=1713324093|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2364_E470(Me)_DB_01.jpg?t=1713324093|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2364_IF_01.jpg?t=1713324093|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2364_E471(Me)(2)_ChIP_01.jpg?t=1713324093 [Review] => 2 [Publication] => 6 [MoleculeName] => H3K36me1 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Symmetric DiMethyl-Histone H4-R3 Rabbit pAb [_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Symmetric DiMethyl-Histone H4-R3 [_keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, Symmetric DiMethyl-Histone H4-R3, Symmetric DiMethylHistone H4-R3, Symmetric DiMethyl Histone H4-R3, H4R3me2s, H4R3,KO/KDantibody8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H [_Symbol] => H4C14 [_GeneID] => 8359 [id] => 7577 [catid] => 413 [title] => Symmetric DiMethyl-Histone H4-R3 Rabbit pAb [url] => /catalog/A3159 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A3159 [Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Symmetric DiMethyl-Histone H4-R3 [description] => Symmetric DiMethyl-Histone H4-R3 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => 15kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H4 (NP_003529.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:2000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => Symmetric DiMethyl R3 [field_s10] => Unconjugated [field_s12] => [keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, Symmetric DiMethyl-Histone H4-R3, Symmetric DiMethylHistone H4-R3, Symmetric DiMethyl Histone H4-R3, H4R3me2s, H4R3,KO/KD抗体8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H [field_l3] => MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931-5(Me)_WB_01.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(6-7)(Me)_WB_01.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_DB_01.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_07.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_10.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_08.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_04.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_01.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_06.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_05.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_09.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_11.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_03.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_02.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_IF_01.jpg?t=1713324770 [Review] => 0 [Publication] => 7 [MoleculeName] => H4R3me2S [recommend] => 0 [status] => 1 [Symbol] => H4C14 [posid] => 1 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H3-K27 Rabbit pAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3 [_Symbol] => H3C1 [_GeneID] => 8290/8350 [id] => 8314 [catid] => 413 [title] => MonoMethyl-Histone H3-K27 Rabbit pAb [url] => /catalog/A2361 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2361 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K27 [description] => MonoMethyl-Histone H3-K27 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic monomethylated peptide around K27 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => yes [field_s9] => MonoMethyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3 [field_l3] => ARKSA [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_N2510(11-12)(Me)_WB_01.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_E458(Me)_DB_01.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_E458(Me)PuFt_IHC_01.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_E458(Me)PuFt_IHC_02.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_E458(Me)PuFt_IHC_03.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_N20652-5(Me)_IF_01.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_N20652-5(Me)_IF_02.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_N20655-5(Me)_ChIP_01.jpg?t=1715048281 [Review] => 1 [Publication] => 6 [MoleculeName] => H3K27me1 [recommend] => 0 [status] => 1 [Symbol] => H3C1 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H4-K20 Rabbit pAb [_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; MonoMethyl-Histone H4-K20 [_keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, MonoMethyl-Histone H4-K20, MonoMethylHistone H4-K20, MonoMethyl Histone H4-K20, H4K20me1, H4K20,KO/KDantibody8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/ [_Symbol] => H4C14 [_GeneID] => 8359 [id] => 8299 [catid] => 413 [title] => MonoMethyl-Histone H4-K20 Rabbit pAb [url] => /catalog/A2370 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2370 [Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; MonoMethyl-Histone H4-K20 [description] => MonoMethyl-Histone H4-K20 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => 11kDa [field_s4] => A synthetic monomethylated peptide around K20 of human Histone H4 (NP_003529.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => MonoMethyl K20 [field_s10] => Unconjugated [field_s12] => [keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, MonoMethyl-Histone H4-K20, MonoMethylHistone H4-K20, MonoMethyl Histone H4-K20, H4K20me1, H4K20,KO/KD抗体8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/ [field_l3] => HRKVL [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_N15553-5(Me)_WB_01.jpg?t=1715048365|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_N15553-5(Me)_WB_02.jpg?t=1715048365|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_E295(Me)(2)_DotBlot_02.jpg?t=1715048365|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_N602(H)(Me)(A)_IHC_01.jpg?t=1715048365|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_N602(H)(Me)(A)_IHC_02.jpg?t=1715048365|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_N602(H)(Me)(A)_IHC_03.jpg?t=1715048365|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_IF_01.jpg?t=1715048365 [Review] => 1 [Publication] => 5 [MoleculeName] => H4K20me1 [recommend] => 0 [status] => 1 [Symbol] => H4C14 [posid] => 1 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )