我们为您找到 His 的 21 个相关产品结果。 您可以根据左侧筛选功能来找到您需要的产品。

Array ( [_title] => DHX9/RNA Helicase A Rabbit mAb [_Synonyms] => LKP; RHA; DDX9; NDH2; NDHII; DHX9/RNA Helicase A [_keywords] => DHX9, DDX9, LKP, NDH2, NDHII, RHA, DExH-box helicase 9, ATP-dependent RNA helicase A|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9|DEAH (Asp-Glu-Ala-His) box helicase 9|DEAH (Asp-Glu-Ala-His) box polypeptide 9|DEAH box protein 9|DEAH-box helicase 9|RNA helicase A|leukophysin|nuclear DNA helicase II, Q08211, DHX9/RNA Helicase A,KO/KDantibodyDHX9, DDX9, LKP, NDH2, NDHII, RHA, DExH-box helicase 9, ATP-dependent RNA helicase A|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9|DEAH (Asp-Glu-Ala-His) box helicase 9|DEAH (Asp-Glu-Ala-His) box polypeptide 9|DEAH box protein 9|DEAH-box helicase 9|RNA helicase A|leukophysin|nuclear DNA helicase II, Q08211, DHX9/RNA Helicase A,PTMantibody [_Symbol] => DHX9 [_GeneID] => 1660 [id] => 21445 [catid] => 130 [title] => DHX9/RNA Helicase A Rabbit mAb [url] => /catalog/A4563 [price] => 50 μL,1200,In Stock|100 μL,2200,In Stock|200 μL,3100,In Stock [CatalogNo] => A4563 [Synonyms] => LKP; RHA; DDX9; NDH2; NDHII; DHX9/RNA Helicase A [description] => DHX9/RNA Helicase A Rabbit mAb [applications] => ELISA,WB,IHC-P,IF/ICC,IP [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => 141kDa [field_s3] => 141kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human DHX9/RNA Helicase A (Q08211). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:2000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells [field_s8] => [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => DHX9, DDX9, LKP, NDH2, NDHII, RHA, DExH-box helicase 9, ATP-dependent RNA helicase A|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9|DEAH (Asp-Glu-Ala-His) box helicase 9|DEAH (Asp-Glu-Ala-His) box polypeptide 9|DEAH box protein 9|DEAH-box helicase 9|RNA helicase A|leukophysin|nuclear DNA helicase II, Q08211, DHX9/RNA Helicase A,KO/KD抗体DHX9, DDX9, LKP, NDH2, NDHII, RHA, DExH-box helicase 9, ATP-dependent RNA helicase A|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 9|DEAH (Asp-Glu-Ala-His) box helicase 9|DEAH (Asp-Glu-Ala-His) box polypeptide 9|DEAH box protein 9|DEAH-box helicase 9|RNA helicase A|leukophysin|nuclear DNA helicase II, Q08211, DHX9/RNA Helicase A,PTM抗体 [field_l3] => ITGLRAAMEALVVEVTKQPAIISQLDPVNERMLNMIRQISRPSAAGINLMIGSTRYGDGPRPPKMARYDNGSGYRRGGSSYSGGGYGGGYSSGGYGSGGYG [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4563_ARC1033_WB_01.jpg?t=1702605067|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4563_ARC1033_IHC_01.jpg?t=1702605067|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4563_ARC1033_IHC_02.jpg?t=1702605067|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4563_ARC1033_IHC_03.jpg?t=1702605067|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4563_ARC1033_IHC_04.jpg?t=1702605067|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4563_ARC1033_IHC_05.jpg?t=1702605067|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4563_ARC1033_IHC_06.jpg?t=1702605067|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4563_ARC1033_IHC_07.jpg?t=1702605067|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4563_ARC1033_IHC_08.jpg?t=1702605067|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4563_ARC1033_IHC_09.jpg?t=1702605067|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4563_ARC1033_IF_01.jpg?t=1702605067|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4563_ARC1033_IP_01.jpg?t=1702605067 [Review] => 0 [Publication] => 2 [MoleculeName] => [recommend] => 1 [status] => 1 [Symbol] => DHX9 [posid] => 0 [GeneID] => Array ( [0] => 1660 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MDA5 Rabbit mAb [_Synonyms] => AGS7; Hlcd; MDA5; IMD95; MDA-5; RLR-2; IDDM19; SGMRT1 [_keywords] => IFIH1, AGS7, Hlcd, IDDM19, MDA-5, MDA5, RLR-2, SGMRT1, interferon induced with helicase C domain 1, interferon-induced helicase C domain-containing protein 1|CADM-140 autoantigen|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide|RIG-I-like receptor 2|RNA helicase-DEAD box protein 116|clinically amyopathic dermatomyositis autoantigen 140 kDa|helicard|helicase with 2 CARD domains|melanoma differentiation-associated gene 5|melanoma differentiation-associated protein 5|murabutide down-regulated protein, Q9BYX4,KO/KDantibodyIFIH1, AGS7, Hlcd, IDDM19, MDA-5, MDA5, RLR-2, SGMRT1, interferon induced with helicase C domain 1, interferon-induced helicase C domain-containing protein 1|CADM-140 autoantigen|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide|RIG-I-like receptor 2|RNA helicase-DEAD box protein 116|clinically amyopathic dermatomyositis autoantigen 140 kDa|helicard|helicase with 2 CARD domains|melanoma differentiation-associated gene 5|melanoma differentiation-associated protein 5|murabutide down-regulated protein, Q9BYX4 [_Symbol] => IFIH1 [_GeneID] => 64135 [id] => 24674 [catid] => 130 [title] => MDA5 Rabbit mAb [url] => /catalog/A2419 [price] => 50 μL,1200,|100 μL,2200,|200 μL,3100, [CatalogNo] => A2419 [Synonyms] => AGS7; Hlcd; MDA5; IMD95; MDA-5; RLR-2; IDDM19; SGMRT1 [description] => MDA5 Rabbit mAb [applications] => ELISA,WB [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => 117kDa [field_s3] => 135kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human MDA5 (Q9BYX4). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000 [field_s8] => [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => IFIH1, AGS7, Hlcd, IDDM19, MDA-5, MDA5, RLR-2, SGMRT1, interferon induced with helicase C domain 1, interferon-induced helicase C domain-containing protein 1|CADM-140 autoantigen|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide|RIG-I-like receptor 2|RNA helicase-DEAD box protein 116|clinically amyopathic dermatomyositis autoantigen 140 kDa|helicard|helicase with 2 CARD domains|melanoma differentiation-associated gene 5|melanoma differentiation-associated protein 5|murabutide down-regulated protein, Q9BYX4,KO/KD抗体IFIH1, AGS7, Hlcd, IDDM19, MDA-5, MDA5, RLR-2, SGMRT1, interferon induced with helicase C domain 1, interferon-induced helicase C domain-containing protein 1|CADM-140 autoantigen|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide|RIG-I-like receptor 2|RNA helicase-DEAD box protein 116|clinically amyopathic dermatomyositis autoantigen 140 kDa|helicard|helicase with 2 CARD domains|melanoma differentiation-associated gene 5|melanoma differentiation-associated protein 5|murabutide down-regulated protein, Q9BYX4 [field_l3] => PSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2419_ARC0760_WB_01.jpg?t=1715752583|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2419_ARC0760_WB_02.jpg?t=1715752583 [Review] => 0 [Publication] => 5 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => IFIH1 [posid] => 0 [GeneID] => Array ( [0] => 64135 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DDX5 Rabbit mAb [_Synonyms] => p68; HLR1; G17P1; HUMP68; DDX5 [_keywords] => DDX5, G17P1, HLR1, HUMP68, p68, DEAD-box helicase 5, probable ATP-dependent RNA helicase DDX5|ATP-dependent RNA helicase DDX5|DEAD (Asp-Glu-Ala-Asp) box helicase 5|DEAD (Asp-Glu-Ala-Asp) box polypeptide 5|DEAD box protein 5|DEAD box-5|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 5 (RNA helicase, 68kD)|RNA helicase p68, P17844,KO/KDantibodyDDX5, G17P1, HLR1, HUMP68, p68, DEAD-box helicase 5, probable ATP-dependent RNA helicase DDX5|ATP-dependent RNA helicase DDX5|DEAD (Asp-Glu-Ala-Asp) box helicase 5|DEAD (Asp-Glu-Ala-Asp) box polypeptide 5|DEAD box protein 5|DEAD box-5|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 5 (RNA helicase, 68kD)|RNA helicase p68, P17844,PTMantibody [_Symbol] => DDX5 [_GeneID] => 1655 [id] => 21125 [catid] => 130 [title] => DDX5 Rabbit mAb [url] => /catalog/A11339 [price] => 50 μL,1200,In Stock|100 μL,2200,In Stock|200 μL,3100,In Stock [CatalogNo] => A11339 [Synonyms] => p68; HLR1; G17P1; HUMP68; DDX5 [description] => DDX5 Rabbit mAb [applications] => ELISA,WB,IHC-P,IF/ICC,IP [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => 69kDa [field_s3] => 69kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDX5 (P17844). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:2000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
IP,0.5μg-4μg antibody for 400μg-600μg extracts of whole cells [field_s8] => [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => DDX5, G17P1, HLR1, HUMP68, p68, DEAD-box helicase 5, probable ATP-dependent RNA helicase DDX5|ATP-dependent RNA helicase DDX5|DEAD (Asp-Glu-Ala-Asp) box helicase 5|DEAD (Asp-Glu-Ala-Asp) box polypeptide 5|DEAD box protein 5|DEAD box-5|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 5 (RNA helicase, 68kD)|RNA helicase p68, P17844,KO/KD抗体DDX5, G17P1, HLR1, HUMP68, p68, DEAD-box helicase 5, probable ATP-dependent RNA helicase DDX5|ATP-dependent RNA helicase DDX5|DEAD (Asp-Glu-Ala-Asp) box helicase 5|DEAD (Asp-Glu-Ala-Asp) box polypeptide 5|DEAD box protein 5|DEAD box-5|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 5 (RNA helicase, 68kD)|RNA helicase p68, P17844,PTM抗体 [field_l3] => MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEAN [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11339_ARC0575_WB_01.jpg?t=1704263558|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11339_ARC0575_IHC_01.jpg?t=1704263558|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11339_ARC0575_IHC_02.jpg?t=1704263558|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11339_ARC0575_IHC_03.jpg?t=1704263558|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11339_ARC0575_IHC_04.jpg?t=1704263558|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11339_ARC0575_IHC_05.jpg?t=1704263558|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11339_ARC0575_IHC_06.jpg?t=1704263558|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11339_ARC0575_IHC_07.jpg?t=1704263558|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11339_ARC0575_IHC_08.jpg?t=1704263558|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11339_ARC0575_IHC_09.jpg?t=1704263558|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11339_ARC0575_IHC_10.jpg?t=1704263558|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11339_ARC0575_IHC_11.jpg?t=1704263558|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11339_ARC0575_IF_03.jpg?t=1704263558|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11339_ARC0575_IF_02.jpg?t=1704263558|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11339_ARC0575_IF_01.jpg?t=1704263558|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11339_ARC0575_IP_01.jpg?t=1704263558 [Review] => 0 [Publication] => 2 [MoleculeName] => [recommend] => 1 [status] => 1 [Symbol] => DDX5 [posid] => 0 [GeneID] => Array ( [0] => 1655 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DDX6 Rabbit mAb [_Synonyms] => P54; RCK; HLR2; IDDILF; Rck/p54; DDX6 [_keywords] => DDX6, HLR2, P54, RCK, DEAD-box helicase 6, probable ATP-dependent RNA helicase DDX6|ATP-dependent RNA helicase p54|DEAD (Asp-Glu-Ala-Asp) box helicase 6|DEAD (Asp-Glu-Ala-Asp) box polypeptide 6|DEAD box protein 6|DEAD box-6|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 6 (RNA helicase, 54kD)|oncogene RCK, P26196,KO/KDantibodyDDX6, HLR2, P54, RCK, DEAD-box helicase 6, probable ATP-dependent RNA helicase DDX6|ATP-dependent RNA helicase p54|DEAD (Asp-Glu-Ala-Asp) box helicase 6|DEAD (Asp-Glu-Ala-Asp) box polypeptide 6|DEAD box protein 6|DEAD box-6|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 6 (RNA helicase, 54kD)|oncogene RCK, P26196,PTMantibody [_Symbol] => DDX6 [_GeneID] => 1656 [id] => 21876 [catid] => 130 [title] => DDX6 Rabbit mAb [url] => /catalog/A9634 [price] => 50 μL,1200,In Stock|100 μL,2200,In Stock|200 μL,3100,In Stock [CatalogNo] => A9634 [Synonyms] => P54; RCK; HLR2; IDDILF; Rck/p54; DDX6 [description] => DDX6 Rabbit mAb [applications] => ELISA,WB,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => 54kDa [field_s3] => 54kDa [field_s4] => Recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human DDX6 (P26196). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:2000
IF/ICC,1:50 - 1:200 [field_s8] => [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => DDX6, HLR2, P54, RCK, DEAD-box helicase 6, probable ATP-dependent RNA helicase DDX6|ATP-dependent RNA helicase p54|DEAD (Asp-Glu-Ala-Asp) box helicase 6|DEAD (Asp-Glu-Ala-Asp) box polypeptide 6|DEAD box protein 6|DEAD box-6|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 6 (RNA helicase, 54kD)|oncogene RCK, P26196,KO/KD抗体DDX6, HLR2, P54, RCK, DEAD-box helicase 6, probable ATP-dependent RNA helicase DDX6|ATP-dependent RNA helicase p54|DEAD (Asp-Glu-Ala-Asp) box helicase 6|DEAD (Asp-Glu-Ala-Asp) box polypeptide 6|DEAD box protein 6|DEAD box-6|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 6 (RNA helicase, 54kD)|oncogene RCK, P26196,PTM抗体 [field_l3] => YCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATT [pics] => https://img.abclonal.com.cn/abclonal/Catalog/A9634/A9634_1.jpg?t=1688173636|https://img.abclonal.com.cn/abclonal/Catalog/A9634/A9634_2.jpg?t=1688173660|https://img.abclonal.com.cn/abclonal/Catalog/A9634/A9634_3.jpg?t=1688173679 [Review] => 0 [Publication] => 1 [MoleculeName] => [recommend] => 1 [status] => 1 [Symbol] => DDX6 [posid] => 0 [GeneID] => Array ( [0] => 1656 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DDX1 Rabbit mAb [_Synonyms] => DBP-RB; UKVH5d; DDX1 [_keywords] => 1653,sc-49817,sc-134752,DBP RB,DDX1,DEAD box protein 1,UKVH5d,DBP-RB,DEAD-box helicase 1,ATP-dependent RNA helicase DDX1,DEAD (Asp-Glu-Ala-Asp) box helicase 1,DEAD (Asp-Glu-Ala-Asp) box polypeptide 1,DEAD box polypeptide 1,DEAD box protein retinoblastoma,DEAD box-1,DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1,DEAD/H-box helicase 1,Q92499,DEAD-Box Helicase 1,DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 1,DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1,DEAD (Asp-Glu-Ala-Asp) Box Helicase 1,DEAD Box Protein Retinoblastoma,DEAD Box Protein 1,ATP-Dependent RNA Helicase DDX1,DEAD Box Polypeptide 1,DEAD/H-Box Helicase 1,EC 3.6.4.13,DEAD Box-1,KO/KDantibody1653,sc-49817,sc-134752,DBP RB,DDX1,DEAD box protein 1,UKVH5d,DBP-RB,DEAD-box helicase 1,ATP-dependent RNA helicase DDX1,DEAD (Asp-Glu-Ala-Asp) box helicase 1,DEAD (Asp-Glu-Ala-Asp) box polypeptide 1,DEAD box polypeptide 1,DEAD box protein retinoblastoma,DEAD box-1,DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1,DEAD/H-box helicase 1,Q92499,DEAD-Box Helicase 1,DEAD/H (Asp- [_Symbol] => DDX1 [_GeneID] => 1653 [id] => 44436 [catid] => 130 [title] => DDX1 Rabbit mAb [url] => /catalog/A25806 [price] => 50 μL,1200,In Stock|100 μL,2200,In Stock|200 μL,3100,In Stock [CatalogNo] => A25806 [Synonyms] => DBP-RB; UKVH5d; DDX1 [description] => DDX1 Rabbit mAb [applications] => ELISA,WB,IHC-P,IP [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => 82kDa [field_s3] => 82kDa [field_s4] => Recombinant fusion protein containing a sequence corresponding to amino acids 441-740 of human DDX1 (NP_004930.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:2000 - 1:10000
IHC-P,1:1000 - 1:5000
IP,0.5μg-4μg antibody for 400μg-600μg extracts of whole cells [field_s8] => [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => 1653,sc-49817,sc-134752,DBP RB,DDX1,DEAD box protein 1,UKVH5d,DBP-RB,DEAD-box helicase 1,ATP-dependent RNA helicase DDX1,DEAD (Asp-Glu-Ala-Asp) box helicase 1,DEAD (Asp-Glu-Ala-Asp) box polypeptide 1,DEAD box polypeptide 1,DEAD box protein retinoblastoma,DEAD box-1,DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1,DEAD/H-box helicase 1,Q92499,DEAD-Box Helicase 1,DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 1,DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1,DEAD (Asp-Glu-Ala-Asp) Box Helicase 1,DEAD Box Protein Retinoblastoma,DEAD Box Protein 1,ATP-Dependent RNA Helicase DDX1,DEAD Box Polypeptide 1,DEAD/H-Box Helicase 1,EC 3.6.4.13,DEAD Box-1,KO/KD抗体1653,sc-49817,sc-134752,DBP RB,DDX1,DEAD box protein 1,UKVH5d,DBP-RB,DEAD-box helicase 1,ATP-dependent RNA helicase DDX1,DEAD (Asp-Glu-Ala-Asp) box helicase 1,DEAD (Asp-Glu-Ala-Asp) box polypeptide 1,DEAD box polypeptide 1,DEAD box protein retinoblastoma,DEAD box-1,DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1,DEAD/H-box helicase 1,Q92499,DEAD-Box Helicase 1,DEAD/H (Asp- [field_l3] => VHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25806_ARC65523-01_WB_01.jpg?t=1718275576|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25806_ARC65523-01_WB_02.jpg?t=1718275576|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25806_ARC65523-01_IHC_01.jpg?t=1718275576|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25806_ARC65523-01_IHC_02.jpg?t=1718275576|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25806_ARC65523-01_IHC_03.jpg?t=1718275576|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25806_ARC65523-01_IHC_04.jpg?t=1718275576|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25806_ARC65523-01_IHC_05.jpg?t=1718275576|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25806_ARC65523-01_IP_01.jpg?t=1718275576 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => DDX1 [posid] => 0 [GeneID] => Array ( [0] => 1653 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DDX17 Rabbit mAb [_Synonyms] => P72; RH70; DDX17 [_keywords] => DDX17, P72, RH70, DEAD-box helicase 17, probable ATP-dependent RNA helicase DDX17|DEAD (Asp-Glu-Ala-Asp) box helicase 17|DEAD (Asp-Glu-Ala-Asp) box polypeptide 17|DEAD box protein p72|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17 (72kD)|RNA-dependent helicase p72, Q92841,KO/KDantibodyDDX17, P72, RH70, DEAD-box helicase 17, probable ATP-dependent RNA helicase DDX17|DEAD (Asp-Glu-Ala-Asp) box helicase 17|DEAD (Asp-Glu-Ala-Asp) box polypeptide 17|DEAD box protein p72|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17 (72kD)|RNA-dependent helicase p72, Q92841,PTMantibody [_Symbol] => DDX17 [_GeneID] => 10521 [id] => 21713 [catid] => 130 [title] => DDX17 Rabbit mAb [url] => /catalog/A5731 [price] => 50 μL,1200,In Stock|100 μL,2200,In Stock|200 μL,3100,In Stock [CatalogNo] => A5731 [Synonyms] => P72; RH70; DDX17 [description] => DDX17 Rabbit mAb [applications] => ELISA,WB,IHC-P [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => 80kDa [field_s3] => 72kDa/82kDa [field_s4] => Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human DDX17 (Q92841). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:2000
IHC-P,1:50 - 1:200 [field_s8] => [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => DDX17, P72, RH70, DEAD-box helicase 17, probable ATP-dependent RNA helicase DDX17|DEAD (Asp-Glu-Ala-Asp) box helicase 17|DEAD (Asp-Glu-Ala-Asp) box polypeptide 17|DEAD box protein p72|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17 (72kD)|RNA-dependent helicase p72, Q92841,KO/KD抗体DDX17, P72, RH70, DEAD-box helicase 17, probable ATP-dependent RNA helicase DDX17|DEAD (Asp-Glu-Ala-Asp) box helicase 17|DEAD (Asp-Glu-Ala-Asp) box polypeptide 17|DEAD box protein p72|DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17 (72kD)|RNA-dependent helicase p72, Q92841,PTM抗体 [field_l3] => RGGGGLPPKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQ [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A5731_ARC1413_WB_01.jpg?t=1697161833|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A5731_ARC1413_WB_02.jpg?t=1697161833|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A5731_ARC1413_IHC_01.jpg?t=1697161833|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A5731_ARC1413_IHC_02.jpg?t=1697161833|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A5731_ARC1413_IHC_03.jpg?t=1697161833|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A5731_ARC1413_IHC_04.jpg?t=1697161833|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A5731_ARC1413_IHC_05.jpg?t=1697161833|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A5731_ARC1413_IHC_06.jpg?t=1697161833|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A5731_ARC1413_IHC_07.jpg?t=1697161833|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A5731_ARC1413_IHC_08.jpg?t=1697161833 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 1 [status] => 1 [Symbol] => DDX17 [posid] => 0 [GeneID] => Array ( [0] => 10521 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => PIAS1+PIAS2 Rabbit mAb [_Synonyms] => DDXBP1; GBP; GU/RH-II; ZMIZ3; PIAS1+PIAS2 [_keywords] => PIAS1, DDXBP1, GBP, GU/RH-II, ZMIZ3, protein inhibitor of activated STAT 1, E3 SUMO-protein ligase PIAS1|AR interacting protein|DEAD/H (Asp-Glu-Ala-Asp/His) box binding protein 1|DEAD/H box-binding protein 1|RNA helicase II-binding protein|gu-binding protein|protein inhibitor of activated STAT protein 1|zinc finger, MIZ-type containing 3, O75925, PIAS1+PIAS2,KO/KDantibodyPIAS1, DDXBP1, GBP, GU/RH-II, ZMIZ3, protein inhibitor of activated STAT 1, E3 SUMO-protein ligase PIAS1|AR interacting protein|DEAD/H (Asp-Glu-Ala-Asp/His) box binding protein 1|DEAD/H box-binding protein 1|RNA helicase II-binding protein|gu-binding protein|protein inhibitor of activated STAT protein 1|zinc finger, MIZ-type containing 3, O75925, PIAS1+PIAS2,PTMantibody [_Symbol] => PIAS1/PIAS2 [_GeneID] => 8554/ 9063 [id] => 23611 [catid] => 130 [title] => PIAS1+PIAS2 Rabbit mAb [url] => /catalog/A9670 [price] => 50 μL,1200,In Stock|100 μL,2200,In Stock|200 μL,3100,In Stock [CatalogNo] => A9670 [Synonyms] => DDXBP1; GBP; GU/RH-II; ZMIZ3; PIAS1+PIAS2 [description] => PIAS1+PIAS2 Rabbit mAb [applications] => ELISA,WB,IHC-P [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => 76kDa [field_s3] => 76kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 552-651 of human PIAS1+PIAS2 (O75925). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:2000
IHC-P,1:50 - 1:200 [field_s8] => [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => PIAS1, DDXBP1, GBP, GU/RH-II, ZMIZ3, protein inhibitor of activated STAT 1, E3 SUMO-protein ligase PIAS1|AR interacting protein|DEAD/H (Asp-Glu-Ala-Asp/His) box binding protein 1|DEAD/H box-binding protein 1|RNA helicase II-binding protein|gu-binding protein|protein inhibitor of activated STAT protein 1|zinc finger, MIZ-type containing 3, O75925, PIAS1+PIAS2,KO/KD抗体PIAS1, DDXBP1, GBP, GU/RH-II, ZMIZ3, protein inhibitor of activated STAT 1, E3 SUMO-protein ligase PIAS1|AR interacting protein|DEAD/H (Asp-Glu-Ala-Asp/His) box binding protein 1|DEAD/H box-binding protein 1|RNA helicase II-binding protein|gu-binding protein|protein inhibitor of activated STAT protein 1|zinc finger, MIZ-type containing 3, O75925, PIAS1+PIAS2,PTM抗体 [field_l3] => DNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A9670_ARC1690_WB_01.jpg?t=1705995165|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A9670_ARC1690_IHC_03.jpg?t=1705995165|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A9670_ARC1690_IHC_02.jpg?t=1705995165|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A9670_ARC1690_IHC_04.jpg?t=1705995165|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A9670_ARC1690_IHC_05.jpg?t=1705995165|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A9670_ARC1690_IHC_06.jpg?t=1705995165|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A9670_ARC1690_IHC_01.jpg?t=1705995165|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A9670_ARC1690_IHC_07.jpg?t=1705995165 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 1 [status] => 1 [Symbol] => PIAS1/PIAS2 [posid] => 0 [GeneID] => Array ( [0] => 8554 [1] => 9063 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Rig-I/DDX58 Rabbit mAb [_Synonyms] => RIG1; DDX58; RIG-I; RLR-1; SGMRT2; Rig-I/DDX58 [_keywords] => sc-48929, sc-48932, sc-98911, DDX58, DEAD box protein 58, RIG 1, RIG I, RIG-I, RIGI, RLR-1, SGMRT2, DExD/H-box helicase 58, probable ATP-dependent RNA helicase DDX58, DEAD (Asp-Glu-Ala-Asp) box polypeptide 58, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, RNA helicase RIG-I, retinoic acid-inducible gene 1 protein, retinoic acid-inducible gene I protein, O95786, 23586, RLR1, RLR 1, sc48929, sc 48929, sc48932, sc 48932, sc98911, sc 98911, DKFZp434J1111, DKFZp686N19181, FLJ13599, Rig-I/DDX58,KO/KDantibodysc-48929, sc-48932, sc-98911, DDX58, DEAD box protein 58, RIG 1, RIG I, RIG-I, RIGI, RLR-1, SGMRT2, DExD/H-box helicase 58, probable ATP-dependent RNA helicase DDX58, DEAD (Asp-Glu-Ala-Asp) box polypeptide 58, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, RNA helicase RIG-I, retinoic acid-inducible gene 1 protein, retinoic acid-inducible gene I protein, O95786, 23586, RLR1, RLR 1, sc48929, sc 48929, sc48932, sc 48932, sc98911, sc 98911, DKFZp434J1111, DKFZp686N19181, FLJ13599, Rig-I/DDX58,PTMantibody [_Symbol] => RIGI [_GeneID] => 23586 [id] => 34944 [catid] => 130 [title] => Rig-I/DDX58 Rabbit mAb [url] => /catalog/A23179 [price] => 50 μL,1200,In Stock|100 μL,2200,In Stock|200 μL,3100,In Stock [CatalogNo] => A23179 [Synonyms] => RIG1; DDX58; RIG-I; RLR-1; SGMRT2; Rig-I/DDX58 [description] => Rig-I/DDX58 Rabbit mAb [applications] => ELISA,WB [Species] => Rabbit [field_s1] => Human, Rat [field_s2] => 107kDa [field_s3] => 107kDa [field_s4] => Recombinant fusion protein containing a sequence corresponding to amino acids 241-455 of human Rig-I/DDX58 (NP_055129.2). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:2000 - 1:4000 [field_s8] => [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => sc-48929, sc-48932, sc-98911, DDX58, DEAD box protein 58, RIG 1, RIG I, RIG-I, RIGI, RLR-1, SGMRT2, DExD/H-box helicase 58, probable ATP-dependent RNA helicase DDX58, DEAD (Asp-Glu-Ala-Asp) box polypeptide 58, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, RNA helicase RIG-I, retinoic acid-inducible gene 1 protein, retinoic acid-inducible gene I protein, O95786, 23586, RLR1, RLR 1, sc48929, sc 48929, sc48932, sc 48932, sc98911, sc 98911, DKFZp434J1111, DKFZp686N19181, FLJ13599, Rig-I/DDX58,KO/KD抗体sc-48929, sc-48932, sc-98911, DDX58, DEAD box protein 58, RIG 1, RIG I, RIG-I, RIGI, RLR-1, SGMRT2, DExD/H-box helicase 58, probable ATP-dependent RNA helicase DDX58, DEAD (Asp-Glu-Ala-Asp) box polypeptide 58, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, RNA helicase RIG-I, retinoic acid-inducible gene 1 protein, retinoic acid-inducible gene I protein, O95786, 23586, RLR1, RLR 1, sc48929, sc 48929, sc48932, sc 48932, sc98911, sc 98911, DKFZp434J1111, DKFZp686N19181, FLJ13599, Rig-I/DDX58,PTM抗体 [field_l3] => FKPRNYQLELALPAMKGKNTIICAPTGCGKTFVSLLICEHHLKKFPQGQKGKVVFFANQIPVYEQQKSVFSKYFERHGYRVTGISGATAENVPVEQIVENNDIIILTPQILVNNLKKGTIPSLSIFTLMIFDECHNTSKQHPYNMIMFNYLDQKLGGSSGPLPQVIGLTASVGVGDAKNTDEALDYICKLCASLDASVIATVKHNLEELEQVVYK [pics] => https://img.abclonal.com.cn/abclonal/Catalog/A23179/A23179_1.jpg?t=1687953001 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => RIGI [posid] => 0 [GeneID] => Array ( [0] => 23586 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => [KO Validated] Histone H2A.Z Rabbit mAb [_Synonyms] => H2AZ; H2A.z; H2A/z; H2AFZ; H2A.Z-1; .Z [_keywords] => H2AFZ, H2A.Z-1, H2A.z, H2A/z, H2AZ, H2A histone family member Z, histone H2A.Z|H2AZ histone, P0C0S5, H2A.Z, .Z,KO/KDantibodyH2AFZ, H2A.Z-1, H2A.z, H2A/z, H2AZ, H2A histone family member Z, histone H2A.Z|H2AZ histone, P0C0S5, H2A.Z, .Z,PTMantibody [_Symbol] => H2AZ1 [_GeneID] => 3015 [id] => 21449 [catid] => 130 [title] => [KO Validated] Histone H2A.Z Rabbit mAb [url] => /catalog/A4599 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A4599 [Synonyms] => H2AZ; H2A.z; H2A/z; H2AFZ; H2A.Z-1; .Z [description] => [KO Validated] Histone H2A.Z Rabbit mAb [applications] => ELISA,WB,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 13kDa [field_s3] => 15kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2A.Z (P0C0S5). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:1000 - 1:5000
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => H2AFZ, H2A.Z-1, H2A.z, H2A/z, H2AZ, H2A histone family member Z, histone H2A.Z|H2AZ histone, P0C0S5, H2A.Z, .Z,KO/KD抗体H2AFZ, H2A.Z-1, H2A.z, H2A/z, H2AZ, H2A histone family member Z, histone H2A.Z|H2AZ histone, P0C0S5, H2A.Z, .Z,PTM抗体 [field_l3] => MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSL [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4599_ARC1048_WB_01.jpg?t=1713324858|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4599_ARC1048_KO-WB_01.jpg?t=1713324858|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A4599_ARC1048_ChIP_01.jpg?t=1713324858 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 1 [status] => 1 [Symbol] => H2AZ1 [posid] => 0 [GeneID] => Array ( [0] => 3015 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Histone H3 Rabbit mAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Histone H3 [_keywords] => HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1|H3 histone family, member A|histone 1, H3a|histone H3/a|histone cluster 1, H3a, P68431, marker, Chromatin, Chromatin marker, CUT&Tag, Histone H3,KO/KDantibodyHIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1|H3 histone family, member A|histone 1, H3a|histone H3/a|histone cluster 1, H3a, P68431, marker, Chromatin, Chromatin marker, CUT&Tag, Histone H3,PTMantibody [_Symbol] => H3C1/H3-4 [_GeneID] => 8290/8350 [id] => 24080 [catid] => 130 [title] => Histone H3 Rabbit mAb [url] => /catalog/A17562 [price] => 50 μL,1200,In Stock|100 μL,2200,In Stock|200 μL,3100,In Stock [CatalogNo] => A17562 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Histone H3 [description] => Histone H3 Rabbit mAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1|H3 histone family, member A|histone 1, H3a|histone H3/a|histone cluster 1, H3a, P68431, marker, Chromatin, Chromatin marker, CUT&Tag, Histone H3,KO/KD抗体HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1|H3 histone family, member A|histone 1, H3a|histone H3/a|histone cluster 1, H3a, P68431, marker, Chromatin, Chromatin marker, CUT&Tag, Histone H3,PTM抗体 [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-01_WB_01.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-01_IHC_01.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-01_IHC_02.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-01_IHC_03.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-03_IF_03.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-03_IF_01.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-03_IF_02.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-01_ChIP_01.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-01_ChIP_02.jpg?t=1715043362 [Review] => 2 [Publication] => 11 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1/H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Histone H2A Rabbit mAb [_Synonyms] => H2A.1; H2A.2; H2A/a; H2AC4; H2AFA; HIST1H2AE; Histone H2A [_keywords] => HIST1H2AE, H2A.1, H2A.2, H2A/a, H2AFA, histone cluster 1 H2A family member e, histone H2A type 1-B/E|H2A histone family, member A|histone 1, H2ae|histone H2A/a|histone H2AE|histone cluster 1, H2ae, P04908, Histone H2A,KO/KDantibodyHIST1H2AE, H2A.1, H2A.2, H2A/a, H2AFA, histone cluster 1 H2A family member e, histone H2A type 1-B/E|H2A histone family, member A|histone 1, H2ae|histone H2A/a|histone H2AE|histone cluster 1, H2ae, P04908, Histone H2A,PTMantibody [_Symbol] => H2AC8 [_GeneID] => 3012/8329 [id] => 23547 [catid] => 130 [title] => Histone H2A Rabbit mAb [url] => /catalog/A3692 [price] => 50 μL,1200,In Stock|100 μL,2200,In Stock|200 μL,3100,In Stock [CatalogNo] => A3692 [Synonyms] => H2A.1; H2A.2; H2A/a; H2AC4; H2AFA; HIST1H2AE; Histone H2A [description] => Histone H2A Rabbit mAb [applications] => ELISA,WB,IHC-P,IP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 14kDa [field_s3] => 14kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2A (P04908). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:100 - 1:500
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells [field_s8] => [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => HIST1H2AE, H2A.1, H2A.2, H2A/a, H2AFA, histone cluster 1 H2A family member e, histone H2A type 1-B/E|H2A histone family, member A|histone 1, H2ae|histone H2A/a|histone H2AE|histone cluster 1, H2ae, P04908, Histone H2A,KO/KD抗体HIST1H2AE, H2A.1, H2A.2, H2A/a, H2AFA, histone cluster 1 H2A family member e, histone H2A type 1-B/E|H2A histone family, member A|histone 1, H2ae|histone H2A/a|histone H2AE|histone cluster 1, H2ae, P04908, Histone H2A,PTM抗体 [field_l3] => MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGR [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3692_ARC2072_WB_01.jpg?t=1713324819|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3692_ARC2072_WB_02.jpg?t=1713324819|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3692_ARC2072_IHC_01.jpg?t=1713324819|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3692_ARC2072_IHC_02.jpg?t=1713324819|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3692_ARC2072_IHC_03.jpg?t=1713324819|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3692_ARC2072_IHC_04.jpg?t=1713324819|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3692_ARC2072_IHC_05.jpg?t=1713324819|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3692_ARC2072_IHC_06.jpg?t=1713324819|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3692_ARC2072_IHC_07.jpg?t=1713324819|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3692_ARC2072_IP_01.jpg?t=1713324819 [Review] => 0 [Publication] => 7 [MoleculeName] => [recommend] => 1 [status] => 1 [Symbol] => H2AC8 [posid] => 0 [GeneID] => Array ( [0] => 3012 [1] => 8329 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Histone H2AX Rabbit mAb [_Synonyms] => H2A.X; H2A/X; H2AFX; Histone H2AX [_keywords] => H2AFX, H2A.X, H2A/X, H2AX, H2A histone family member X, histone H2AX|H2AX histone|histone H2A.x, P16104, Histone H2AX,KO/KDantibodyH2AFX, H2A.X, H2A/X, H2AX, H2A histone family member X, histone H2AX|H2AX histone|histone H2A.x, P16104, Histone H2AX,PTMantibody [_Symbol] => H2AX [_GeneID] => 3014 [id] => 21957 [catid] => 130 [title] => Histone H2AX Rabbit mAb [url] => /catalog/A11412 [price] => 50 μL,1200,In Stock|100 μL,2200,In Stock|200 μL,3100,In Stock [CatalogNo] => A11412 [Synonyms] => H2A.X; H2A/X; H2AFX; Histone H2AX [description] => Histone H2AX Rabbit mAb [applications] => ELISA,WB,IHC-P,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 15kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2AX (P16104). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:2000
IHC-P,1:200 - 1:800
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => H2AFX, H2A.X, H2A/X, H2AX, H2A histone family member X, histone H2AX|H2AX histone|histone H2A.x, P16104, Histone H2AX,KO/KD抗体H2AFX, H2A.X, H2A/X, H2AX, H2A histone family member X, histone H2AX|H2AX histone|histone H2A.x, P16104, Histone H2AX,PTM抗体 [field_l3] => MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGG [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11412_ARC0590_WB_02.jpg?t=1713322242|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11412_ARC0590_IHC_01.jpg?t=1713322242|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11412_ARC0590_IHC_07.jpg?t=1713322242|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11412_ARC0590_IHC_02.jpg?t=1713322242|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11412_ARC0590_IHC_08.jpg?t=1713322242|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11412_ARC0590_IHC_03.jpg?t=1713322242|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11412_ARC0590_IHC_04.jpg?t=1713322242|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11412_ARC0590_IHC_05.jpg?t=1713322242|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11412_ARC0590_IHC_06.jpg?t=1713322242|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11412_ARC0590_ChIP_01.jpg?t=1713322242 [Review] => 0 [Publication] => 3 [MoleculeName] => [recommend] => 1 [status] => 1 [Symbol] => H2AX [posid] => 0 [GeneID] => Array ( [0] => 3014 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Histone H1.2 Rabbit mAb [_Synonyms] => H1C; H1.2; H1F2; H1s-1; HIST1H1C; Histone H1.2 [_keywords] => HIST1H1C, H1.2, H1C, H1F2, H1s-1, histone cluster 1 H1 family member c, histone H1.2|H1 histone family, member 2|histone 1, H1c|histone H1c|histone H1d|histone H1s-1|histone cluster 1, H1c, P16403, Histone H1.2,KO/KDantibodyHIST1H1C, H1.2, H1C, H1F2, H1s-1, histone cluster 1 H1 family member c, histone H1.2|H1 histone family, member 2|histone 1, H1c|histone H1c|histone H1d|histone H1s-1|histone cluster 1, H1c, P16403, Histone H1.2,PTMantibody [_Symbol] => H1-2 [_GeneID] => 3006 [id] => 30775 [catid] => 130 [title] => Histone H1.2 Rabbit mAb [url] => /catalog/A0646 [price] => 50 μL,1200,|100 μL,2200,|200 μL,3100, [CatalogNo] => A0646 [Synonyms] => H1C; H1.2; H1F2; H1s-1; HIST1H1C; Histone H1.2 [description] => Histone H1.2 Rabbit mAb [applications] => ELISA,WB,IF/ICC [Species] => Rabbit [field_s1] => Human,Mouse,Rat, Other (Wide Range Predicted) [field_s2] => 21kDa [field_s3] => 32kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H1.2 (P16403). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:1000 -1:5000
IF/ICC,1:50 - 1:500 [field_s8] => [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => HIST1H1C, H1.2, H1C, H1F2, H1s-1, histone cluster 1 H1 family member c, histone H1.2|H1 histone family, member 2|histone 1, H1c|histone H1c|histone H1d|histone H1s-1|histone cluster 1, H1c, P16403, Histone H1.2,KO/KD抗体HIST1H1C, H1.2, H1C, H1F2, H1s-1, histone cluster 1 H1 family member c, histone H1.2|H1 histone family, member 2|histone 1, H1c|histone H1c|histone H1d|histone H1s-1|histone cluster 1, H1c, P16403, Histone H1.2,PTM抗体 [field_l3] => MSETAPAAPAAAPPAEKAPVKKKAAKKAGGTPRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTG [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A0646_ARC1836_WB_01.jpg?t=1713322159|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A0646_ARC1836_WB_02.jpg?t=1713322159|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A0646_ARC1836_IF_01.jpg?t=1713322159 [Review] => 0 [Publication] => 1 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H1-2 [posid] => 0 [GeneID] => Array ( [0] => 3006 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Histone H2B Rabbit mAb [_Synonyms] => H2BK; H2B/S; H2BFT; H2BFAiii; HIST1H2BK; Histone H2B [_keywords] => HIST1H2BK, H2B/S, H2BFAiii, H2BFT, H2BK, histone cluster 1 H2B family member k, histone H2B type 1-K|H2B K|H2B histone family, member T|HIRA-interacting protein 1|histone 1, H2bk|histone cluster 1, H2bk|histone family member, O60814, Histone H2B,KO/KDantibodyHIST1H2BK, H2B/S, H2BFAiii, H2BFT, H2BK, histone cluster 1 H2B family member k, histone H2B type 1-K|H2B K|H2B histone family, member T|HIRA-interacting protein 1|histone 1, H2bk|histone cluster 1, H2bk|histone family member, O60814, Histone H2B,PTMantibody [_Symbol] => H2BC12 [_GeneID] => 3017/8349 [id] => 24077 [catid] => 130 [title] => Histone H2B Rabbit mAb [url] => /catalog/A19812 [price] => 50 μL,1200,In Stock|100 μL,2200,In Stock|200 μL,3100,In Stock [CatalogNo] => A19812 [Synonyms] => H2BK; H2B/S; H2BFT; H2BFAiii; HIST1H2BK; Histone H2B [description] => Histone H2B Rabbit mAb [applications] => ELISA,WB,IHC-P [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 14kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 47-126 of human Histone H2B (O60814). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200 [field_s8] => [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => HIST1H2BK, H2B/S, H2BFAiii, H2BFT, H2BK, histone cluster 1 H2B family member k, histone H2B type 1-K|H2B K|H2B histone family, member T|HIRA-interacting protein 1|histone 1, H2bk|histone cluster 1, H2bk|histone family member, O60814, Histone H2B,KO/KD抗体HIST1H2BK, H2B/S, H2BFAiii, H2BFT, H2BK, histone cluster 1 H2B family member k, histone H2B type 1-K|H2B K|H2B histone family, member T|HIRA-interacting protein 1|histone 1, H2bk|histone cluster 1, H2bk|histone family member, O60814, Histone H2B,PTM抗体 [field_l3] => KQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19812_ARC2337_WB-01.jpg?t=1713322852|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19812_ARC2337_IHC_01.jpg?t=1713322852|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19812_ARC2337_IHC_02.jpg?t=1713322852|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19812_ARC2337_IHC_03.jpg?t=1713322852|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19812_ARC2337_IHC_04.jpg?t=1713322852|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19812_ARC2337_IHC_05.jpg?t=1713322852|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19812_ARC2337_IHC_06.jpg?t=1713322852 [Review] => 0 [Publication] => 1 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H2BC12 [posid] => 0 [GeneID] => Array ( [0] => 3017 [1] => 8349 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Histone H3 Rabbit mAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Histone H3 [_keywords] => HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1|H3 histone family, member A|histone 1, H3a|histone H3/a|histone cluster 1, H3a, P68431, marker, Chromatin, Chromatin marker, CUT&Tag, Histone H3,PTMantibody [_Symbol] => H3C1 [_GeneID] => 8290/8350 [id] => 16988 [catid] => 130 [title] => Histone H3 Rabbit mAb [url] => /catalog/A22348 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22348 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Histone H3 [description] => Histone H3 Rabbit mAb [applications] => ELISA,WB,IHC-P,IF/ICC,CUT&Tag [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa/ [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:2000 - 1:4800
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
CUT&Tag, 10⁵ cells /1 μg [field_s8] => [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1|H3 histone family, member A|histone 1, H3a|histone H3/a|histone cluster 1, H3a, P68431, marker, Chromatin, Chromatin marker, CUT&Tag, Histone H3,PTM抗体 [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22348_ARC50519-03_ChIP-seq_01.jpg?t=1713323641|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22348_ARC50519-04_WB_01.jpg?t=1713323641|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22348_ARC50519-03_IHC_01.jpg?t=1713323641|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22348_ARC50519-03_IHC_02.jpg?t=1713323641|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22348_ARC50519-03_IHC_03.jpg?t=1713323641|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22348_ARC50519-03_IHC_04.jpg?t=1713323641|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22348_ARC50519-03_IHC_05.jpg?t=1713323641|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22348_ARC50519-03_IHC_06.jpg?t=1713323641|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22348_ARC50519-03_IHC_07.jpg?t=1713323641|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22348_ARC50519-03_IHC_08.jpg?t=1713323641|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22348_ARC50519-03_IHC_09.jpg?t=1713323641|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22348_ARC50519-03_IHC_10.jpg?t=1713323641|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22348_ARC50519-03_IHC_11.jpg?t=1713323641|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22348_ARC50519-03_IHC_12.jpg?t=1713323641|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22348_ARC50519-03_IF_01.jpg?t=1713323641|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22348_ARC50519-03_IF_02.jpg?t=1713323641|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22348_ARC50519-03_IF_03.jpg?t=1713323641 [Review] => 0 [Publication] => 1 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )