我们为您找到 His 的 7 个相关产品结果。 您可以根据左侧筛选功能来找到您需要的产品。

Array ( [_title] => Symmetric DiMethyl-Histone H4-R3 Rabbit pAb [_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Symmetric DiMethyl-Histone H4-R3 [_keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, Symmetric DiMethyl-Histone H4-R3, Symmetric DiMethylHistone H4-R3, Symmetric DiMethyl Histone H4-R3, H4R3me2s, H4R3,KO/KDantibody8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H [_Symbol] => H4C14 [_GeneID] => 8359 [id] => 7577 [catid] => 413 [title] => Symmetric DiMethyl-Histone H4-R3 Rabbit pAb [url] => /catalog/A3159 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A3159 [Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Symmetric DiMethyl-Histone H4-R3 [description] => Symmetric DiMethyl-Histone H4-R3 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => 15kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H4 (NP_003529.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:2000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => Symmetric DiMethyl R3 [field_s10] => Unconjugated [field_s12] => [keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, Symmetric DiMethyl-Histone H4-R3, Symmetric DiMethylHistone H4-R3, Symmetric DiMethyl Histone H4-R3, H4R3me2s, H4R3,KO/KD抗体8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H [field_l3] => MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931-5(Me)_WB_01.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(6-7)(Me)_WB_01.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_DB_01.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_07.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_10.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_08.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_04.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_01.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_06.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_05.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_09.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_11.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_03.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_02.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_IF_01.jpg?t=1713324770 [Review] => 0 [Publication] => 7 [MoleculeName] => H4R3me2S [recommend] => 0 [status] => 1 [Symbol] => H4C14 [posid] => 1 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H4-K20 Rabbit pAb [_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; MonoMethyl-Histone H4-K20 [_keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, MonoMethyl-Histone H4-K20, MonoMethylHistone H4-K20, MonoMethyl Histone H4-K20, H4K20me1, H4K20,KO/KDantibody8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/ [_Symbol] => H4C14 [_GeneID] => 8359 [id] => 8299 [catid] => 413 [title] => MonoMethyl-Histone H4-K20 Rabbit pAb [url] => /catalog/A2370 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2370 [Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; MonoMethyl-Histone H4-K20 [description] => MonoMethyl-Histone H4-K20 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => 11kDa [field_s4] => A synthetic monomethylated peptide around K20 of human Histone H4 (NP_003529.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => MonoMethyl K20 [field_s10] => Unconjugated [field_s12] => [keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, MonoMethyl-Histone H4-K20, MonoMethylHistone H4-K20, MonoMethyl Histone H4-K20, H4K20me1, H4K20,KO/KD抗体8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/ [field_l3] => HRKVL [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_N15553-5(Me)_WB_01.jpg?t=1715048365|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_N15553-5(Me)_WB_02.jpg?t=1715048365|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_E295(Me)(2)_DotBlot_02.jpg?t=1715048365|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_N602(H)(Me)(A)_IHC_01.jpg?t=1715048365|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_N602(H)(Me)(A)_IHC_02.jpg?t=1715048365|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_N602(H)(Me)(A)_IHC_03.jpg?t=1715048365|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_IF_01.jpg?t=1715048365 [Review] => 1 [Publication] => 5 [MoleculeName] => H4K20me1 [recommend] => 0 [status] => 1 [Symbol] => H4C14 [posid] => 1 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H4-K20 Rabbit pAb [_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; TriMethyl-Histone H4-K20 [_keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, TriMethyl-Histone H4-K20, TriMethylHistone H4-K20, TriMethyl Histone H4-K20, H4K20me3, H4K20,KO/KDantibody8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, [_Symbol] => H4C14 [_GeneID] => 8359 [id] => 8298 [catid] => 413 [title] => TriMethyl-Histone H4-K20 Rabbit pAb [url] => /catalog/A2372 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2372 [Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; TriMethyl-Histone H4-K20 [description] => TriMethyl-Histone H4-K20 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => 11kDa [field_s4] => A synthetic trimethylated peptide around K20 of human histone H4 (NP_003529.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:2000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => TriMethyl K20 [field_s10] => Unconjugated [field_s12] => [keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, TriMethyl-Histone H4-K20, TriMethylHistone H4-K20, TriMethyl Histone H4-K20, H4K20me3, H4K20,KO/KD抗体8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, [field_l3] => HRKVL [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2372_N23913-5(Me)_WB_01.jpg?t=1715048388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2372_E305(Me)(2)_DotBlot_01.jpg?t=1715048388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2372_N602(H)(Me)(AX)_IHC_01.jpg?t=1715048388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2372_N602(H)(Me)(AX)_IHC_02.jpg?t=1715048388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2372_IF_01.jpg?t=1715048388 [Review] => 1 [Publication] => 5 [MoleculeName] => H4K20me3 [recommend] => 0 [status] => 1 [Symbol] => H4C14 [posid] => 1 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Asymmetric DiMethyl-Histone H4-R3 Rabbit pAb [_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Asymmetric DiMethyl-Histone H4-R3 [_keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, Asymmetric DiMethyl-Histone H4-R3, Asymmetric DiMethylHistone H4-R3, Asymmetric DiMethyl Histone H4-R3, H4R3me2a, H3t, H3.4, H3/g, H3FT, H4R3,KO/KDantibody8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, [_Symbol] => H4C14 [_GeneID] => 8359 [id] => 8285 [catid] => 413 [title] => Asymmetric DiMethyl-Histone H4-R3 Rabbit pAb [url] => /catalog/A2376 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2376 [Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Asymmetric DiMethyl-Histone H4-R3 [description] => Asymmetric DiMethyl-Histone H4-R3 Rabbit pAb [applications] => ELISA,WB,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => 11kDa [field_s4] => A synthetic asymmetric dimethylated peptide around R3 of human histone H4 (NP_003539.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:2000
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => Asymmetric DiMethyl R3 [field_s10] => Unconjugated [field_s12] => [keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, Asymmetric DiMethyl-Histone H4-R3, Asymmetric DiMethylHistone H4-R3, Asymmetric DiMethyl Histone H4-R3, H4R3me2a, H3t, H3.4, H3/g, H3FT, H4R3,KO/KD抗体8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, [field_l3] => SGRGK [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2376_K49(Me)_WB_01.jpg?t=1711176903|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2376_DB_01.jpg?t=1711176903|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2376_IF_01.jpg?t=1711176903 [Review] => 1 [Publication] => 3 [MoleculeName] => H4R3me2a [recommend] => 0 [status] => 1 [Symbol] => H4C14 [posid] => 1 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DiMethyl-Histone H4-K20 Rabbit pAb [_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; DiMethyl-Histone H4-K20 [_keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, DiMethyl-Histone H4-K20, DiMethylHistone H4-K20, DiMethyl Histone H4-K20, H4K20me2, H4K20,KO/KDantibody8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/ [_Symbol] => H4C14 [_GeneID] => 8359 [id] => 8300 [catid] => 413 [title] => DiMethyl-Histone H4-K20 Rabbit pAb [url] => /catalog/A2371 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2371 [Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; DiMethyl-Histone H4-K20 [description] => DiMethyl-Histone H4-K20 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => 11kDa [field_s4] => A synthetic dimethylated peptide around K20 of human histone H4 (NP_003529.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => DiMethyl K20 [field_s10] => Unconjugated [field_s12] => [keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, DiMethyl-Histone H4-K20, DiMethylHistone H4-K20, DiMethyl Histone H4-K20, H4K20me2, H4K20,KO/KD抗体8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/ [field_l3] => HRKVL [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2371_N5354-5(Me)_WB_02.jpg?t=1715048378|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2371_DB_01.jpg?t=1715048378|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2371_N650(H)(Me)(A)_IHC_01.jpg?t=1715048378|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2371_N650(H)(Me)(A)_IHC_02.jpg?t=1715048378|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2371_IF_01.jpg?t=1715048378 [Review] => 2 [Publication] => 2 [MoleculeName] => H4K20me2 [recommend] => 0 [status] => 1 [Symbol] => H4C14 [posid] => 1 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H4-K5 Rabbit pAb [_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; MonoMethyl-Histone H4-K5 [_keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, Symmetric DiMethyl-Histone H4-R3, Symmetric DiMethylHistone H4-R3, Symmetric DiMethyl Histone H4-R3, H4R3me2s, H4K5, MonoMethyl-Histone H4-K5,KO/KDantibody8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, [_Symbol] => H4C14 [_GeneID] => 8359 [id] => 18243 [catid] => 413 [title] => MonoMethyl-Histone H4-K5 Rabbit pAb [url] => /catalog/A17859 [price] => 50 μL,1180,In Stock|100 μL,1860,In Stock|200 μL,2980,In Stock [CatalogNo] => A17859 [Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; MonoMethyl-Histone H4-K5 [description] => MonoMethyl-Histone H4-K5 Rabbit pAb [applications] => ELISA,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => Refer to figures [field_s4] => A synthetic monomethylated peptide around K5 of human Histone H4 (NP_003529.1). [field_s5] => Human [field_s6] => IgG [field_s7] => IF/ICC,1:50 - 1:200 [field_s8] => [field_s9] => MonoMethyl-Histone K5 [field_s10] => Unconjugated [field_s12] => [keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, Symmetric DiMethyl-Histone H4-R3, Symmetric DiMethylHistone H4-R3, Symmetric DiMethyl Histone H4-R3, H4R3me2s, H4K5, MonoMethyl-Histone H4-K5,KO/KD抗体8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, [field_l3] => RGKGG [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17859_Q6916Me_IF_01.jpg?t=1713322547 [Review] => 0 [Publication] => 0 [MoleculeName] => H4K5me1 [recommend] => 0 [status] => 1 [Symbol] => H4C14 [posid] => 0 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H4-R3 Rabbit pAb [_Synonyms] => H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4FA; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; HIST1H4A; MonoMethyl-Histone H4-R3 [_keywords] => 8359, HIST1H4A, H4FA, histone cluster 1 H4 family member a, histone H4, H4 histone family, member A, histone 1, H4a, histone cluster 1, P62805, Histone Cluster 1 H4 Family Member A, H4 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H4, HIST2H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/N, H4/O, H4F2, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FN, H4FO, HIST4H4, H4/p, histone cluster 4 H4, histone 4, H4, 121504, MonoMethyl R3, H4R3, MonoMethyl-Histone H4-R3,PTMantibody8359, HIST1H4A, H4FA, histone cluster 1 H4 family member a, histone H4, H4 histone family, member A, histone 1, H4a, histone cluster 1, P62805, Histone Cluster 1 H4 Family Member A, H4 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H4, HIST2H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/N, H4/O, H4F2, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FN, H4FO, HIST4H4, H4/p, histone cluster 4 H4, histone 4, H4, 121504, MonoMethyl R3 [_Symbol] => H4C1 [_GeneID] => 8359 [id] => 21114 [catid] => 413 [title] => MonoMethyl-Histone H4-R3 Rabbit pAb [url] => /catalog/A17905 [price] => 50 μL,1260,In Stock|100 μL,2000,In Stock|200 μL,3260,In Stock [CatalogNo] => A17905 [Synonyms] => H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4FA; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; HIST1H4A; MonoMethyl-Histone H4-R3 [description] => MonoMethyl-Histone H4-R3 Rabbit pAb [applications] => ELISA,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => Refer to figures [field_s4] => A synthetic monomethylated peptide around R3 of human Histone H4 (NP_003529.1). [field_s5] => Human [field_s6] => IgG [field_s7] => IF/ICC,1:50 - 1:200 [field_s8] => [field_s9] => MonoMethyl R3 [field_s10] => Unconjugated [field_s12] => [keywords] => 8359, HIST1H4A, H4FA, histone cluster 1 H4 family member a, histone H4, H4 histone family, member A, histone 1, H4a, histone cluster 1, P62805, Histone Cluster 1 H4 Family Member A, H4 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H4, HIST2H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/N, H4/O, H4F2, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FN, H4FO, HIST4H4, H4/p, histone cluster 4 H4, histone 4, H4, 121504, MonoMethyl R3, H4R3, MonoMethyl-Histone H4-R3,PTM抗体8359, HIST1H4A, H4FA, histone cluster 1 H4 family member a, histone H4, H4 histone family, member A, histone 1, H4a, histone cluster 1, P62805, Histone Cluster 1 H4 Family Member A, H4 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H4, HIST2H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/N, H4/O, H4F2, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FN, H4FO, HIST4H4, H4/p, histone cluster 4 H4, histone 4, H4, 121504, MonoMethyl R3 [field_l3] => SGRGK [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17905_N2532-5(Me)_IF_01.jpg?t=1714095835 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H4C1 [posid] => 0 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )