我们为您找到 His 的 13 个相关产品结果。 您可以根据左侧筛选功能来找到您需要的产品。

Array ( [_title] => TriMethyl-Histone H3-K4 Rabbit mAb [_Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 33518 [catid] => 413 [title] => TriMethyl-Histone H3-K4 Rabbit mAb [url] => /catalog/A22146 [price] => 50 μL,1600,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22146 [Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [description] => TriMethyl-Histone H3-K4 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,CUT&Tag,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic trimethylated peptide around K4 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:10000 - 1:60000
WB,1:10000- 1:60000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
CUT&Tag, 10⁵ cells /1 μg
ChIP-seq,1:50 - 1:200 [field_s8] => [field_s9] => TriMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_ChIP-seq_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_ChIP-seq_02.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_WB_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_DotBlot_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IHC_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IHC_02.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IHC_03.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IF_03.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IF_02.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IF_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_ChIP_01.jpg?t=1715045739 [Review] => 0 [Publication] => 2 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DiMethyl-Histone H3-K4 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K4 [_keywords] => [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 4500 [catid] => 413 [title] => DiMethyl-Histone H3-K4 Rabbit mAb [url] => /catalog/A22143 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22143 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K4 [description] => DiMethyl-Histone H3-K4 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,IP,ChIP,ChIP-seq,CUT&Tag [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic dimethylated peptide around K4 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:2000 - 1:6000
WB,1:1000 - 1:5000
IHC-P,1:1000 - 1:5000
IF/ICC,1:50 - 1:200
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:50 - 1:200
CUT&Tag,10⁵ cells /1 μg [field_s8] => [field_s9] => DiMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_ChIP-seq_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_cut-tag_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_WB_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_DotBlot_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_02.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_03.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_04.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_05.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IF_02.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IP_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_ChIP_01.jpg?t=1713324352 [Review] => 0 [Publication] => 1 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K4 Rabbit mAb [_Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 33674 [catid] => 413 [title] => TriMethyl-Histone H3-K4 Rabbit mAb [url] => /catalog/A22225 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22225 [Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [description] => TriMethyl-Histone H3-K4 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic trimethylated peptide around K4 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:10000 - 1:60000
WB,1:10000 - 1:30000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => TriMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_WB_01.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_DotBlot_01.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_IHC_01.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_IHC_02.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_IHC_03.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_IF_01.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_ChIP_01.jpg?t=1715045863 [Review] => 0 [Publication] => 1 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DiMethyl-Histone H3-K36 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K36 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker, DiMethyl-Histone H3-K36,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histon [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 33464 [catid] => 413 [title] => DiMethyl-Histone H3-K36 Rabbit mAb [url] => /catalog/A22087 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22087 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K36 [description] => DiMethyl-Histone H3-K36 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,IP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic dimethylated peptide around K36 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:2000 - 1:10000
WB,1:2000 - 1:10000
IHC-P,1:1000 - 1:5000
IF/ICC,1:50 - 1:200
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells [field_s8] => [field_s9] => DiMethyl K36 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker, DiMethyl-Histone H3-K36,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histon [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_WB_01.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_DotBlot_01.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_01.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_02.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_03.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_04.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_05.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_06.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_07.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_08.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IF_01.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IF_02.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IP_01.jpg?t=1713323345 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DiMethyl-Histone H3-K79 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K79 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker, DiMethyl-Histone H3-K79,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histon [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 33463 [catid] => 413 [title] => DiMethyl-Histone H3-K79 Rabbit mAb [url] => /catalog/A22086 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22086 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K79 [description] => DiMethyl-Histone H3-K79 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,IP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic dimethylated peptide around K79 of human Histone H3-K79 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:2000 - 1:20000
WB,1:2000 - 1:20000
IHC-P,1:500 - 1:1000
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
ChIP-seq,1:50 - 1:200 [field_s8] => [field_s9] => DiMethyl K79 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker, DiMethyl-Histone H3-K79,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histon [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_ChIP-seq_01.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_WB_01.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_DotBlot_01.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IHC_05.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IHC_03.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IHC_01.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IHC_02.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IHC_04.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IHC_06.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IF_03.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IF_04.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IP_01.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_ChIP_01.jpg?t=1713323323 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H3-K18 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K18 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker, MonoMethyl-Histone H3-K18,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histon [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 30847 [catid] => 413 [title] => MonoMethyl-Histone H3-K18 Rabbit mAb [url] => /catalog/A20680 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A20680 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K18 [description] => MonoMethyl-Histone H3-K18 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IP,IF/ICC,ChIP,CUT&Tag [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic monomethylated peptide around K18 of human histone H3 (P68431). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
CUT&Tag, 10⁵ cells /1 μg [field_s8] => [field_s9] => MonoMethyl K9 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker, MonoMethyl-Histone H3-K18,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histon [field_l3] => APRKQ [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_ChIP-seq_01.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_WB_01.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_DotBlot_01.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_IHC_01.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_IHC_02.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_IHC_03.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_IF_01.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_IF_02.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_IP_01.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_ChIP_01.jpg?t=1714989343 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H3-K27 Rabbit mAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3 [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 33616 [catid] => 413 [title] => MonoMethyl-Histone H3-K27 Rabbit mAb [url] => /catalog/A22170 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22170 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K27 [description] => MonoMethyl-Histone H3-K27 Rabbit mAb [applications] => ELISA,DB,WB,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic monomethylated peptide around K27 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:10000 - 1:30000
WB,1:10000 - 1:30000
IF/ICC,1:50 - 1:200 [field_s8] => [field_s9] => MonoMethyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3 [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22170_ARC55261-01_WB_01.jpg?t=1713323472|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22170_ARC55261-01_WB_02.jpg?t=1713323472|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22170_ARC55261-01_DotBlot_01.jpg?t=1713323472|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22170_ARC55261-01_IF_01.jpg?t=1713323472|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22170_ARC55261-01_IF_02.jpg?t=1713323472 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H3-K9 Rabbit mAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K9 [_keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, Unmodified, H3K79, marker, Chromatin, Chromatin marker, MonoMethyl-Histone H3-K9,KO/KDantibody8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, H [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 30981 [catid] => 413 [title] => MonoMethyl-Histone H3-K9 Rabbit mAb [url] => /catalog/A20734 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A20734 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K9 [description] => MonoMethyl-Histone H3-K9 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,CUT&Tag [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic monomethylated peptide around K9 of human Histone H3 (P68431). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IHC-P,1:500 - 1:1000
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
CUT&Tag, 10⁵ cells /1 μg [field_s8] => [field_s9] => MonoMethyl K9 [field_s10] => Unconjugated [field_s12] => [keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, Unmodified, H3K79, marker, Chromatin, Chromatin marker, MonoMethyl-Histone H3-K9,KO/KD抗体8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, H [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_ChIP-seq_01.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_WB_01.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_DotBlot_01.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_01.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_02.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_03.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_04.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_05.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_06.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_07.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_08.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_09.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_10.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_11.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_12.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IF_01.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_ChIP_01.jpg?t=1713322990 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H3-K9 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K9 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker, MonoMethyl-Histone H3-K9,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 33414 [catid] => 413 [title] => MonoMethyl-Histone H3-K9 Rabbit mAb [url] => /catalog/A22079 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22079 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K9 [description] => MonoMethyl-Histone H3-K9 Rabbit mAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP,DB [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic monomethylated peptide around K9 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:1000 - 1:5000
IHC-P,1:100 - 1:500
IF/ICC,1:50 - 1:200
DB,1:1000 - 1:5000 [field_s8] => [field_s9] => MonoMethyl K9 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker, MonoMethyl-Histone H3-K9,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22079_ARC54621-01（1比1）_WB_01.jpg?t=1715045601|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22079_ARC54621-01（1比1）_DotBlot_01.jpg?t=1715045601|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22079_ARC54621-01（1比1）_IHC_01.jpg?t=1715045601|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22079_ARC54621-01（1比1）_IHC_02.jpg?t=1715045601|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22079_ARC54621-01（1比1）_IHC_03.jpg?t=1715045601|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22079_ARC54621-01（1比1）_IHC_04.jpg?t=1715045601|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22079_ARC54621-01（1比1）_IF_01.jpg?t=1715045601|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22079_ARC54621-01（1比1）_IF_02.jpg?t=1715045601|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22079_ARC54621-01（1比1）_IF_03.jpg?t=1715045601 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Symmetric DiMethyl-Histone H3-R8 Rabbit mAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Symmetric DiMethyl-Histone H3-R8 [_keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, Asymmetric DiMethyl R17, H3R17, marker, Chromatin, Chromatin marker, Symmetric DiMethyl-Histone H3-R8,KO/KDantibody8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 31321 [catid] => 413 [title] => Symmetric DiMethyl-Histone H3-R8 Rabbit mAb [url] => /catalog/A21207 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A21207 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Symmetric DiMethyl-Histone H3-R8 [description] => Symmetric DiMethyl-Histone H3-R8 Rabbit mAb [applications] => ELISA,WB,DB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic symmetric dimethylated peptide around R8 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:10000 - 1:120000
WB,1:2000 - 1:10000
IHC-P,1:500 - 1:1000
IF/ICC,1:50 - 1:200 [field_s8] => [field_s9] => Symmetric DiMethyl R8 [field_s10] => Unconjugated [field_s12] => [keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, Asymmetric DiMethyl R17, H3R17, marker, Chromatin, Chromatin marker, Symmetric DiMethyl-Histone H3-R8,KO/KD抗体8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21207_ARC53358-01_WB_01.jpg?t=1714990252|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21207_ARC53358-01_DotBlot_01.jpg?t=1714990252|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21207_ARC53358-01_IHC_01.jpg?t=1714990252|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21207_ARC53358-01_IHC_02.jpg?t=1714990252|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21207_ARC53358-01_IHC_03.jpg?t=1714990252|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21207_ARC53358-01_IF_01.jpg?t=1714990252|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21207_ARC53358-01_IF_02.jpg?t=1714990252 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K4 Rabbit mAb [_Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 33672 [catid] => 413 [title] => TriMethyl-Histone H3-K4 Rabbit mAb [url] => /catalog/A22226 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22226 [Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [description] => TriMethyl-Histone H3-K4 Rabbit mAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP,DB [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic trimethylated peptide around K4 of human TriMethyl-Histone H3-K4 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:10000 - 1:40000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
DB,1:10000 - 1:40000 [field_s8] => [field_s9] => TriMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [field_l3] => ARTKQ [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_WB_01.jpg?t=1718876957|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_DotBlot_01.jpg?t=1718876957|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_IHC_01.jpg?t=1718876957|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_IHC_02.jpg?t=1718876957|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_IHC_03.jpg?t=1718876957|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_IHC_04.jpg?t=1718876957|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_IF_01.jpg?t=1718876957|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_IF_02.jpg?t=1718876957|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_IF_03.jpg?t=1718876957|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22226_ARC55094-01_ChIP_01.jpg?t=1718876957 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K4 Rabbit mAb [_Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 33673 [catid] => 413 [title] => TriMethyl-Histone H3-K4 Rabbit mAb [url] => /catalog/A22224 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22224 [Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [description] => TriMethyl-Histone H3-K4 Rabbit mAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => Refer to figures [field_s4] => A synthetic trimethylated peptide around K4 of human TriMethyl-Histone H3-K4 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:10000 - 1:30000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => TriMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [field_l3] => ARTKQ [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22224_ARC55088-01_WB_01.jpg?t=1715045851|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22224_ARC55088-01_IHC_01.jpg?t=1715045851|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22224_ARC55088-01_IHC_02.jpg?t=1715045851|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22224_ARC55088-01_IHC_03.jpg?t=1715045851|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22224_ARC55088-01_IF_01.jpg?t=1715045851|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22224_ARC55088-01_IF_02.jpg?t=1715045851|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22224_ARC55088-01_IF_03.jpg?t=1715045851|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22224_ARC55088-01_ChIP_01.jpg?t=1715045851 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K9 Rabbit mAb [_Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K9 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 15095 [catid] => 413 [title] => TriMethyl-Histone H3-K9 Rabbit mAb [url] => /catalog/A22295 [price] => 50 μL,1600,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22295 [Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K9 [description] => TriMethyl-Histone H3-K9 Rabbit mAb [applications] => ELISA,WB,IF/ICC,ChIP,ChIP-seq,DB,CUT&Tag [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic trimethylated peptide around K9 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:2000 - 1:20000
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100
DB,1:2000 - 1:20000
CUT&Tag,10⁵ cells /1 μg [field_s8] => [field_s9] => TriMethyl K9 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22295_ARC54898-01_ChIP-seq_01.jpg?t=1713323603|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22295_ARC54898-01_cut-tag_01.jpg?t=1713323603|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22295_ARC54898-01_WB_01.jpg?t=1713323603|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22295_ARC54898-01_DotBlot_01.jpg?t=1713323603|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22295_ARC54898-01_IF_01.jpg?t=1713323603|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22295_ARC54898-01_ChIP_01.jpg?t=1713323603 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )