我们为您找到 His 的 58 个相关产品结果。 您可以根据左侧筛选功能来找到您需要的产品。

Array ( [_title] => Acetyl-Histone H3-K9 Rabbit mAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Acetyl-Histone H3-K9 [_keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, H3K23, marker, Chromatin, Chromatin marker, Acetyl-Histone H3-K9,KO/KDantibody8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, His [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 34178 [catid] => 722 [title] => Acetyl-Histone H3-K9 Rabbit mAb [url] => /catalog/A22567 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22567 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Acetyl-Histone H3-K9 [description] => Acetyl-Histone H3-K9 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic acetylated peptide around K9 of human Acetyl-Histone H3-K9 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:10000 - 1:190000
WB,1:2000 - 1:10000
IHC-P,1:500 - 1:1000
IF/ICC,1:500 - 1:1000
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => Acetyl K9 [field_s10] => Unconjugated [field_s12] => [keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, H3K23, marker, Chromatin, Chromatin marker, Acetyl-Histone H3-K9,KO/KD抗体8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, His [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22567_ARC55732-01_WB_01.jpg?t=1715738388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22567_ARC55732-01_WB_02.jpg?t=1715738388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22567_ARC55732-01_DotBlot_01.jpg?t=1715738388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22567_ARC55732-01_IHC_01.jpg?t=1715738388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22567_ARC55732-01_IHC_02.jpg?t=1715738388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22567_ARC55732-01_IHC_03.jpg?t=1715738388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22567_ARC55732-01_IHC_04.jpg?t=1715738388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22567_ARC55732-01_IF_01.jpg?t=1715738388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22567_ARC55732-01_ChIP_01.jpg?t=1715738388 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DiMethyl-Histone H3-K9 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K9 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K9, DiMethylHistone H3-K9, DiMethyl Histone H3-K9, H3K9me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K9, DiMethylHistone H3-K9, DiMethyl Histone H3-K9, H3K9me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, His [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8316 [catid] => 413 [title] => DiMethyl-Histone H3-K9 Rabbit pAb [url] => /catalog/A2359 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2359 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K9 [description] => DiMethyl-Histone H3-K9 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:50 - 1:200 [field_s8] => yes [field_s9] => DiMethyl K9 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K9, DiMethylHistone H3-K9, DiMethyl Histone H3-K9, H3K9me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K9, DiMethylHistone H3-K9, DiMethyl Histone H3-K9, H3K9me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, His [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N18911-5(Me)_WB_01.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_E267(Me)_DB_01.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_aN2524-8(Me)_IHC_01.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_aN2524-8(Me)_IHC_02.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N15425(Me)_IF_01.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N15425(Me)_IF_02.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N15425(Me)_IF_03.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N15425(Me)_IF_04.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N2524-5(Me)_ChIP_01.jpg?t=1715048248 [Review] => 2 [Publication] => 33 [MoleculeName] => H3K9me2 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K4 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K4 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8318 [catid] => 413 [title] => TriMethyl-Histone H3-K4 Rabbit pAb [url] => /catalog/A2357 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2357 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K4 [description] => TriMethyl-Histone H3-K4 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa/ [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:100 - 1:500
IHC-P,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100 [field_s8] => yes [field_s9] => TriMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2357_N20423-6(Me)_WB_01.jpg?t=1718074106|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2357_N20423-6(Me)_WB_02.jpg?t=1718074106|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2357_MP55090-01_MP55094-02_WB_01.jpg?t=1718074106|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2357_G195(Me)_DB_01.jpg?t=1718074106|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2357_N14968-5(Me)_IHC_01.jpg?t=1718074106|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2357_N14968-5(Me)_IHC_02.jpg?t=1718074106|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2357_N20427-5(Me)_ChIP_01.jpg?t=1718074106 [Review] => 8 [Publication] => 66 [MoleculeName] => H3K4me3 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Acetyl-Histone H3-K27 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,PTMantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1 [_Symbol] => H3C1/H3-4 [_GeneID] => 8290/8350 [id] => 33917 [catid] => 722 [title] => Acetyl-Histone H3-K27 Rabbit mAb [url] => /catalog/A22264 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22264 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K27 [description] => Acetyl-Histone H3-K27 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic acetylated peptide around K27 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:2000 - 1:20000
WB,1:2000 - 1:20000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:50 - 1:200 [field_s8] => [field_s9] => Acetyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,PTM抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1 [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_ChIP-seq_01.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_WB_01.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_WB_02.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_WB_03.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_DotBlot_01.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_IHC_01.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_IHC_02.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_IHC_03.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-03_IF_01.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_ChIP_01.jpg?t=1715737209 [Review] => 0 [Publication] => 3 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1/H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K36 Rabbit mAb [_Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K36 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K36, TriMethylHistone H3-K36, TriMethyl Histone H3-K36, H3K36me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K36,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K36, TriMethylHistone H3-K36, TriMethyl Histone H3-K36, H3K36me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/ [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 24564 [catid] => 413 [title] => TriMethyl-Histone H3-K36 Rabbit mAb [url] => /catalog/A20379 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A20379 [Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K36 [description] => TriMethyl-Histone H3-K36 Rabbit mAb [applications] => ELISA,DB,WB,IP,IHC-P,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => [field_s4] => A synthetic trimethylated peptide around K36 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
IHC-P,1:100 - 1:500
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:50 - 1:100 [field_s8] => [field_s9] => TriMethyl K36 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K36, TriMethylHistone H3-K36, TriMethyl Histone H3-K36, H3K36me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K36,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K36, TriMethylHistone H3-K36, TriMethyl Histone H3-K36, H3K36me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/ [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20379_ARC50050-01_ChIP-seq_01.jpg?t=1713322921|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20379_ARC50050-01_WB_01.jpg?t=1713322921|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20379_ARC50050-01_DotBlot_01.jpg?t=1713322921|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20379_ARC50050-01_IHC_02.jpg?t=1713322921|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20379_ARC50050-01_IHC_01.jpg?t=1713322921|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20379_ARC50050-01_IP_01.jpg?t=1713322921|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20379_ARC50050-01_ChIP_01.jpg?t=1713322921 [Review] => 0 [Publication] => 3 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Acetyl-Histone H3-K27 Rabbit mAb [_Synonyms] => [_keywords] => CUT&Tag, 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker, Acetyl-Histone H3-K27,KO/KDantibodyCUT&Tag, 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Hi [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 24853 [catid] => 722 [title] => Acetyl-Histone H3-K27 Rabbit mAb [url] => /catalog/A2771 [price] => 50 μL,1600,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A2771 [Synonyms] => [description] => Acetyl-Histone H3-K27 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IP,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic acetylated peptide around K27 of human Histone H3 (P68431). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:10000 - 1:120000
IHC-P,1:500 - 1:1000
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
IF/ICC,1:50 - 1:200
ChIP,2μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => Acetyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => CUT&Tag, 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker, Acetyl-Histone H3-K27,KO/KD抗体CUT&Tag, 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Hi [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2771_ARC53670-01_DB_01.jpg?t=1715821361|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2771_ARC53670-02_WB_01.jpg?t=1715821361|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2771_ARC53670-01_IHC_07.jpg?t=1715821361|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2771_ARC53670-01_IHC_04.jpg?t=1715821361|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2771_ARC53670-01_IHC_03.jpg?t=1715821361|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2771_ARC53670-01_IHC_01.jpg?t=1715821361|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2771_ARC53670-01_IHC_02.jpg?t=1715821361|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2771_ARC53670-01_IHC_08.jpg?t=1715821361|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2771_ARC53670-01_IHC_06.jpg?t=1715821361|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2771_ARC53670-01_IHC_05.jpg?t=1715821361|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2771_ARC53670-01_IF_01.jpg?t=1715821361|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2771_ARC53670-02_IP_01.jpg?t=1715821361|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2771_ARC53670-01_ChIP_01.jpg?t=1715821361|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2771_ARC53670-02_ChIP_01.jpg?t=1715821361 [Review] => 0 [Publication] => 2 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Acetyl-Histone H3-K9 Rabbit mAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Acetyl-Histone H3-K9 [_keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, Asymmetric DiMethyl R17, H3R17, marker, Chromatin, Chromatin marker, Acetyl-Histone H3-K9,KO/KDantibody8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histon [_Symbol] => H3C1 [_GeneID] => 8290/8350 [id] => 6104 [catid] => 722 [title] => Acetyl-Histone H3-K9 Rabbit mAb [url] => /catalog/A21107 [price] => 50 μL,1600,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A21107 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Acetyl-Histone H3-K9 [description] => Acetyl-Histone H3-K9 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,IP,ChIP,CUT&Tag,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic acetylated peptide around K9 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IHC-P,1:100 - 1:500
IF/ICC,1:50 - 1:200
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
ChIP,5μg antibody for 5μg-10μg of Chromatin
CUT&Tag, 10⁵ cells /1 μg
ChIP-seq,1:50 - 1:100 [field_s8] => [field_s9] => Acetyl K9 [field_s10] => Unconjugated [field_s12] => [keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, Asymmetric DiMethyl R17, H3R17, marker, Chromatin, Chromatin marker, Acetyl-Histone H3-K9,KO/KD抗体8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histon [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21107_ARC50576-01_ChIP-seq_01.jpg?t=1715675887|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21107_ARC50576-02_ChIP-seq_01.jpg?t=1715675887|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21107_ARC50576-02_ChIP-seq_02.jpg?t=1715675887|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21107_ARC50576-01_WB_01.jpg?t=1715675887|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21107_ARC50576-01_DotBlot_01.jpg?t=1715675887|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21107_ARC50576-02_IHC_01.jpg?t=1715675887|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21107_ARC50576-02_IHC_02.jpg?t=1715675887|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21107_ARC50576-02_IHC_03.jpg?t=1715675887|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21107_ARC50576-02_IHC_04.jpg?t=1715675887|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21107_ARC50576-02_IHC_05.jpg?t=1715675887|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21107_ARC50576-02_IHC_06.jpg?t=1715675887|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21107_ARC50576-02_IHC_07.jpg?t=1715675887|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21107_ARC50576-02_IHC_08.jpg?t=1715675887|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21107_ARC50576-02_IF_01.jpg?t=1715675887|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21107_ARC50576-02_IP_01.jpg?t=1715675887|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21107_ARC50576-01_ChIP_01.jpg?t=1715675887 [Review] => 0 [Publication] => 2 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K4 Rabbit mAb [_Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 33518 [catid] => 413 [title] => TriMethyl-Histone H3-K4 Rabbit mAb [url] => /catalog/A22146 [price] => 50 μL,1600,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22146 [Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [description] => TriMethyl-Histone H3-K4 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,CUT&Tag,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic trimethylated peptide around K4 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:10000 - 1:60000
WB,1:10000- 1:60000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
CUT&Tag, 10⁵ cells /1 μg
ChIP-seq,1:50 - 1:200 [field_s8] => [field_s9] => TriMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_ChIP-seq_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_ChIP-seq_02.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_WB_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_DotBlot_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IHC_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IHC_02.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IHC_03.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IF_03.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IF_02.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IF_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_ChIP_01.jpg?t=1715045739 [Review] => 0 [Publication] => 2 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K9 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K9 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8309 [catid] => 413 [title] => TriMethyl-Histone H3-K9 Rabbit pAb [url] => /catalog/A2360 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2360 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K9 [description] => TriMethyl-Histone H3-K9 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic trimethylated peptide around K9 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:100 - 1:500
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,2.5μg antibody for 5μg-10μg of Chromatin [field_s8] => yes [field_s9] => TriMethyl K9 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [field_l3] => ARKST [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N10094-5(Me)_WB_01.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_E269(Me)_DB_01.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N576(H)(Me)(AX)_IHC_01.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N576(H)(Me)(AX)_IHC_02.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15432-5(Me)_IF_01.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15432-5(Me)_IF_02.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15432-5(Me)_IF_03.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15432-5(Me)_IF_04.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15832-5(Me)_ChIP_01.jpg?t=1715048268 [Review] => 6 [Publication] => 49 [MoleculeName] => H3K9me3 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Acetyl-Histone H4-K12 Rabbit mAb [_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Acetyl-Histone H4-K12 [_keywords] => HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Propionyl-Histone H4-K12, 8370, Acetyl-Histone H4-K12,KO/KDantibodyHIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Propionyl-Histone H4-K12, 8370, Acetyl-Histone H4-K12,PTMantibodyHIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Propionyl-Histone H4-K12, 8370, Acetyl-Histone H4-K12,小分子antibody [_Symbol] => Histone H4 [_GeneID] => 8359 [id] => 34398 [catid] => 722 [title] => Acetyl-Histone H4-K12 Rabbit mAb [url] => /catalog/A22754 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22754 [Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Acetyl-Histone H4-K12 [description] => Acetyl-Histone H4-K12 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => [field_s4] => A synthetic acetylated peptide around K12 of human Histone H4（P62805）. [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IHC-P,1:100 - 1:500
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:50 - 1:200 [field_s8] => [field_s9] => Acetyl K12 [field_s10] => Unconjugated [field_s12] => [keywords] => HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Propionyl-Histone H4-K12, 8370, Acetyl-Histone H4-K12,KO/KD抗体HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Propionyl-Histone H4-K12, 8370, Acetyl-Histone H4-K12,PTM抗体HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Propionyl-Histone H4-K12, 8370, Acetyl-Histone H4-K12,小分子抗体 [field_l3] => MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22754_ARC56881-01_ChIP-seq_01.jpg?t=1715738890|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22754_ARC56881-01_WB_01.jpg?t=1715738890|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22754_ARC56881-01_WB_02.jpg?t=1715738890|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22754_ARC56881-01_WB_03.jpg?t=1715738890|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22754_ARC56881-01_DotBlot_02.jpg?t=1715738890|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22754_ARC56881-01_IHC_05.jpg?t=1715738890|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22754_ARC56881-01_IHC_04.jpg?t=1715738890|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22754_ARC56881-01_IHC_01.jpg?t=1715738890|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22754_ARC56881-01_IHC_03.jpg?t=1715738890|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22754_ARC56881-01_IHC_02.jpg?t=1715738890|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22754_ARC56881-01_ChIP_01.jpg?t=1715738890 [Review] => 0 [Publication] => 1 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H4 [posid] => 0 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Acetyl-Histone H4-K16 Rabbit mAb [_Synonyms] => H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4FA; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; HIST1H4A; Acetyl-Histone H4-K16 [_keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, Acetyl-Histone H4-K16, AcetylHistone H4-K16, Acetyl Histone H4-K16, 121504, H4K16ac, HIST4H4, H4/p, H4K16,KO/KDantibody8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, [_Symbol] => Histone H4 [_GeneID] => 8359/8370 [id] => 34679 [catid] => 722 [title] => Acetyl-Histone H4-K16 Rabbit mAb [url] => /catalog/A23091 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A23091 [Synonyms] => H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4FA; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; H4C16; HIST1H4A; Acetyl-Histone H4-K16 [description] => Acetyl-Histone H4-K16 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => 11kDa [field_s4] => A synthetic acetylated peptide around K16 of human Histone H4 (NP_003529.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:100 - 1:500
WB,1:2000-1:9000
IHC-P,1:1000 - 1:5000
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => Acetyl K16 [field_s10] => Unconjugated [field_s12] => [keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, Acetyl-Histone H4-K16, AcetylHistone H4-K16, Acetyl Histone H4-K16, 121504, H4K16ac, HIST4H4, H4/p, H4K16,KO/KD抗体8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, [field_l3] => MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A23091_ARC55790-01_WB_01.jpg?t=1715740301|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A23091_ARC55790-01_WB_02.jpg?t=1715740301|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A23091_ARC55790-01_WB_03.jpg?t=1715740301|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A23091_ARC55790-01_DotBlot_01.jpg?t=1715740301|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A23091_ARC55790-01_IHC_05.jpg?t=1715740301|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A23091_ARC55790-01_IHC_01.jpg?t=1715740301|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A23091_ARC55790-01_IHC_04.jpg?t=1715740301|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A23091_ARC55790-01_IHC_03.jpg?t=1715740301|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A23091_ARC55790-01_IHC_06.jpg?t=1715740301|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A23091_ARC55790-01_IHC_02.jpg?t=1715740301|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A23091_ARC55790-01_ChIP_01.jpg?t=1715740301 [Review] => 0 [Publication] => 1 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H4 [posid] => 0 [GeneID] => Array ( [0] => 8359 [1] => 8370 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Acetyl-Histone H4-K5 Rabbit mAb [_Synonyms] => H4/p; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; HIST4H4; Acetyl-Histone H4-K5 [_keywords] => 121504, HIST4H4, H4/p, histone cluster 4 H4, histone H4, histone 4, H4, P62805, Histone Cluster 4 H4, Histone 4, Histone Cluster 4, Histone H4, HIST2H4, H4/P, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/N, H4/O, H4F2, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FN, H4FO, H4K5, Acetyl-Histone H4-K5,KO/KDantibody121504, HIST4H4, H4/p, histone cluster 4 H4, histone H4, histone 4, H4, P62805, Histone Cluster 4 H4, Histone 4, Histone Cluster 4, Histone H4, HIST2H4, H4/P, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/N, H4/O, H4F2, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FN, H4FO, H4K5, Acetyl-Histone H4-K5,PTMantibody121504, HIST4H4, H4/p, histone cluster 4 H4, histone H4, histone 4, H4, P62805, Histone Cluster 4 H4, Histone 4, Histone Cluster 4, Histone H4, HIST2H4, H4/P, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/N, H4/O, H4F2, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, [_Symbol] => Histone H4 [_GeneID] => 8359 [id] => 19433 [catid] => 722 [title] => Acetyl-Histone H4-K5 Rabbit mAb [url] => /catalog/A19525 [price] => 50 μL,1580,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A19525 [Synonyms] => H4/p; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4-16; H4C11; H4C12; H4C13; H4C14; H4C15; HIST4H4; Acetyl-Histone H4-K5 [description] => Acetyl-Histone H4-K5 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => 11kDa [field_s4] => A synthetic acetylated peptide around K5 of human Histone H4 (P62805). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200 [field_s8] => [field_s9] => Acetyl K5 [field_s10] => Unconjugated [field_s12] => [keywords] => 121504, HIST4H4, H4/p, histone cluster 4 H4, histone H4, histone 4, H4, P62805, Histone Cluster 4 H4, Histone 4, Histone Cluster 4, Histone H4, HIST2H4, H4/P, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/N, H4/O, H4F2, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FN, H4FO, H4K5, Acetyl-Histone H4-K5,KO/KD抗体121504, HIST4H4, H4/p, histone cluster 4 H4, histone H4, histone 4, H4, P62805, Histone Cluster 4 H4, Histone 4, Histone Cluster 4, Histone H4, HIST2H4, H4/P, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/N, H4/O, H4F2, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FN, H4FO, H4K5, Acetyl-Histone H4-K5,PTM抗体121504, HIST4H4, H4/p, histone cluster 4 H4, histone H4, histone 4, H4, P62805, Histone Cluster 4 H4, Histone 4, Histone Cluster 4, Histone H4, HIST2H4, H4/P, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/N, H4/O, H4F2, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, [field_l3] => MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19525_ARC0002_WB_01.jpg?t=1715668422|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19525_ARC0002_DotBlot_01.jpg?t=1715668422|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19525_ARC0002_IHC_02.jpg?t=1715668422|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19525_ARC0002_IHC_01.jpg?t=1715668422|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19525_ARC0002_IHC_03.jpg?t=1715668422|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19525_ARC0002_IF_01.jpg?t=1715668422|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19525_ARC0002_IF_02.jpg?t=1715668422|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A19525_ARC0002_IF_03.jpg?t=1715668422 [Review] => 0 [Publication] => 1 [MoleculeName] => H4 K5ac [recommend] => 1 [status] => 1 [Symbol] => Histone H4 [posid] => 0 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DiMethyl-Histone H3-K4 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K4 [_keywords] => [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 4500 [catid] => 413 [title] => DiMethyl-Histone H3-K4 Rabbit mAb [url] => /catalog/A22143 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22143 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K4 [description] => DiMethyl-Histone H3-K4 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,IP,ChIP,ChIP-seq,CUT&Tag [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic dimethylated peptide around K4 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:2000 - 1:6000
WB,1:1000 - 1:5000
IHC-P,1:1000 - 1:5000
IF/ICC,1:50 - 1:200
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:50 - 1:200
CUT&Tag,10⁵ cells /1 μg [field_s8] => [field_s9] => DiMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_ChIP-seq_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_cut-tag_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_WB_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_DotBlot_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_02.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_03.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_04.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_05.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IF_02.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IP_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_ChIP_01.jpg?t=1713324352 [Review] => 0 [Publication] => 1 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K4 Rabbit mAb [_Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 33674 [catid] => 413 [title] => TriMethyl-Histone H3-K4 Rabbit mAb [url] => /catalog/A22225 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22225 [Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [description] => TriMethyl-Histone H3-K4 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic trimethylated peptide around K4 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:10000 - 1:60000
WB,1:10000 - 1:30000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => TriMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_WB_01.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_DotBlot_01.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_IHC_01.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_IHC_02.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_IHC_03.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_IF_01.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_ChIP_01.jpg?t=1715045863 [Review] => 0 [Publication] => 1 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Acetyl-Histone H3-K18 Rabbit mAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Acetyl-Histone H3-K18 [_keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, H3K23, marker, Chromatin, Chromatin marker, Acetyl-Histone H3-K18,KO/KDantibody8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Hi [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 34163 [catid] => 722 [title] => Acetyl-Histone H3-K18 Rabbit mAb [url] => /catalog/A22566 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22566 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Acetyl-Histone H3-K18 [description] => Acetyl-Histone H3-K18 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic acetylated peptide around K18 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:2000 - 1:10000
WB,1:2000 - 1:10000
IHC-P,1:100 - 1:500
IF/ICC,1:500 - 1:1000
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => Acetyl K18 [field_s10] => Unconjugated [field_s12] => [keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, H3K23, marker, Chromatin, Chromatin marker, Acetyl-Histone H3-K18,KO/KD抗体8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Hi [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22566_ARC55729-01_WB_01.jpg?t=1715738236|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22566_ARC55729-01_WB_02.jpg?t=1715738236|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22566_ARC55729-01_WB_03.jpg?t=1715738236|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22566_ARC55729-01_DotBlot_01.jpg?t=1715738236|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22566_ARC55729-01_IHC_01.jpg?t=1715738236|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22566_ARC55729-01_IHC_02.jpg?t=1715738236|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22566_ARC55729-01_IHC_03.jpg?t=1715738236|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22566_ARC55729-01_IHC_04.jpg?t=1715738236|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22566_ARC55729-01_IF_01.jpg?t=1715738236|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22566_ARC55729-01_ChIP_01.jpg?t=1715738236 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )