我们为您找到 His 的 58 个相关产品结果。 您可以根据左侧筛选功能来找到您需要的产品。

Array ( [_title] => MonoMethyl-Histone H3-K9 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K9 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histo [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8315 [catid] => 413 [title] => MonoMethyl-Histone H3-K9 Rabbit pAb [url] => /catalog/A2358 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2358 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K9 [description] => MonoMethyl-Histone H3-K9 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 14kDa [field_s4] => A synthetic monomethylated peptide around K9 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100 [field_s8] => yes [field_s9] => MonoMethyl K9 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histo [field_l3] => ARKST [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_E257(Me)PuFt_WB_01.jpg?t=1715048234|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_E257(Me)_DB_01.jpg?t=1715048234|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_N16085-5(Me)_IHC_01.jpg?t=1715048234|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_N16085-5(Me)_IHC_02.jpg?t=1715048234|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_IF_01.jpg?t=1715048234|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_E257(Me)_IF_01.jpg?t=1715048234|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_E257(Me)_IF_02.jpg?t=1715048234|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_E257(Me)_IF_03.jpg?t=1715048234|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_N13852-6(Me)_ChIP_01.jpg?t=1715048234|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2358_E256(Me)_ChIP_01.jpg?t=1715048234 [Review] => 1 [Publication] => 11 [MoleculeName] => H3K9me1 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Symmetric DiMethyl-Histone H4-R3 Rabbit pAb [_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Symmetric DiMethyl-Histone H4-R3 [_keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, Symmetric DiMethyl-Histone H4-R3, Symmetric DiMethylHistone H4-R3, Symmetric DiMethyl Histone H4-R3, H4R3me2s, H4R3,KO/KDantibody8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H [_Symbol] => H4C14 [_GeneID] => 8359 [id] => 7577 [catid] => 413 [title] => Symmetric DiMethyl-Histone H4-R3 Rabbit pAb [url] => /catalog/A3159 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A3159 [Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Symmetric DiMethyl-Histone H4-R3 [description] => Symmetric DiMethyl-Histone H4-R3 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => 15kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H4 (NP_003529.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:2000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => Symmetric DiMethyl R3 [field_s10] => Unconjugated [field_s12] => [keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, Symmetric DiMethyl-Histone H4-R3, Symmetric DiMethylHistone H4-R3, Symmetric DiMethyl Histone H4-R3, H4R3me2s, H4R3,KO/KD抗体8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H [field_l3] => MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931-5(Me)_WB_01.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(6-7)(Me)_WB_01.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_DB_01.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_07.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_10.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_08.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_04.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_01.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_06.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_05.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_09.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_11.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_03.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_N23931(8-9-0)(Me)_IHC_02.jpg?t=1713324770|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3159_IF_01.jpg?t=1713324770 [Review] => 0 [Publication] => 7 [MoleculeName] => H4R3me2S [recommend] => 0 [status] => 1 [Symbol] => H4C14 [posid] => 1 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K79 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K79 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K79, TriMethylHistone H3-K79, TriMethyl Histone H3-K79, H3K79me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K79, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K79, TriMethylHistone H3-K79, TriMethyl Histone H3-K79, H3K79me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Hi [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8303 [catid] => 413 [title] => TriMethyl-Histone H3-K79 Rabbit pAb [url] => /catalog/A2369 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2369 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K79 [description] => TriMethyl-Histone H3-K79 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic trimethylated peptide around K79 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => yes [field_s9] => TriMethyl K79 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K79, TriMethylHistone H3-K79, TriMethyl Histone H3-K79, H3K79me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K79, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K79, TriMethylHistone H3-K79, TriMethyl Histone H3-K79, H3K79me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Hi [field_l3] => DFKTD [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2369_N726(H)(Me)(AX)_WB_01.jpg?t=1713324163|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2369_N727-4(me)_DotBlot_01.jpg?t=1713324163|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2369_N15599-5(Me)_ChIP_01.jpg?t=1713324163|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2369_N15372-5(Me)_ChIP_01.jpg?t=1713324163 [Review] => 4 [Publication] => 5 [MoleculeName] => H3K79me3 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H3-K27 Rabbit pAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3 [_Symbol] => H3C1 [_GeneID] => 8290/8350 [id] => 8314 [catid] => 413 [title] => MonoMethyl-Histone H3-K27 Rabbit pAb [url] => /catalog/A2361 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2361 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K27 [description] => MonoMethyl-Histone H3-K27 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic monomethylated peptide around K27 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => yes [field_s9] => MonoMethyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3 [field_l3] => ARKSA [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_N2510(11-12)(Me)_WB_01.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_E458(Me)_DB_01.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_E458(Me)PuFt_IHC_01.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_E458(Me)PuFt_IHC_02.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_E458(Me)PuFt_IHC_03.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_N20652-5(Me)_IF_01.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_N20652-5(Me)_IF_02.jpg?t=1715048281|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2361_N20655-5(Me)_ChIP_01.jpg?t=1715048281 [Review] => 1 [Publication] => 6 [MoleculeName] => H3K27me1 [recommend] => 0 [status] => 1 [Symbol] => H3C1 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H4-K20 Rabbit pAb [_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; MonoMethyl-Histone H4-K20 [_keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, MonoMethyl-Histone H4-K20, MonoMethylHistone H4-K20, MonoMethyl Histone H4-K20, H4K20me1, H4K20,KO/KDantibody8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/ [_Symbol] => H4C14 [_GeneID] => 8359 [id] => 8299 [catid] => 413 [title] => MonoMethyl-Histone H4-K20 Rabbit pAb [url] => /catalog/A2370 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2370 [Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; MonoMethyl-Histone H4-K20 [description] => MonoMethyl-Histone H4-K20 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => 11kDa [field_s4] => A synthetic monomethylated peptide around K20 of human Histone H4 (NP_003529.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => MonoMethyl K20 [field_s10] => Unconjugated [field_s12] => [keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, MonoMethyl-Histone H4-K20, MonoMethylHistone H4-K20, MonoMethyl Histone H4-K20, H4K20me1, H4K20,KO/KD抗体8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/ [field_l3] => HRKVL [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_N15553-5(Me)_WB_01.jpg?t=1715048365|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_N15553-5(Me)_WB_02.jpg?t=1715048365|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_E295(Me)(2)_DotBlot_02.jpg?t=1715048365|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_N602(H)(Me)(A)_IHC_01.jpg?t=1715048365|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_N602(H)(Me)(A)_IHC_02.jpg?t=1715048365|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_N602(H)(Me)(A)_IHC_03.jpg?t=1715048365|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2370_IF_01.jpg?t=1715048365 [Review] => 1 [Publication] => 5 [MoleculeName] => H4K20me1 [recommend] => 0 [status] => 1 [Symbol] => H4C14 [posid] => 1 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H4-K20 Rabbit pAb [_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; TriMethyl-Histone H4-K20 [_keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, TriMethyl-Histone H4-K20, TriMethylHistone H4-K20, TriMethyl Histone H4-K20, H4K20me3, H4K20,KO/KDantibody8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, [_Symbol] => H4C14 [_GeneID] => 8359 [id] => 8298 [catid] => 413 [title] => TriMethyl-Histone H4-K20 Rabbit pAb [url] => /catalog/A2372 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2372 [Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; TriMethyl-Histone H4-K20 [description] => TriMethyl-Histone H4-K20 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => 11kDa [field_s4] => A synthetic trimethylated peptide around K20 of human histone H4 (NP_003529.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:2000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => TriMethyl K20 [field_s10] => Unconjugated [field_s12] => [keywords] => 8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/O, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FO, HIST1H4A, TriMethyl-Histone H4-K20, TriMethylHistone H4-K20, TriMethyl Histone H4-K20, H4K20me3, H4K20,KO/KD抗体8370, HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Histone Cluster 2 H4 Family Member A, Histone Cluster 2, H4 Histone, Family 2, Histone 2, H4/N, H4 Histone Family, Member N, Histone IV, Histone H4, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, [field_l3] => HRKVL [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2372_N23913-5(Me)_WB_01.jpg?t=1715048388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2372_E305(Me)(2)_DotBlot_01.jpg?t=1715048388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2372_N602(H)(Me)(AX)_IHC_01.jpg?t=1715048388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2372_N602(H)(Me)(AX)_IHC_02.jpg?t=1715048388|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2372_IF_01.jpg?t=1715048388 [Review] => 1 [Publication] => 5 [MoleculeName] => H4K20me3 [recommend] => 0 [status] => 1 [Symbol] => H4C14 [posid] => 1 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DiMethyl-Histone H3-K27 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K27 [_keywords] => [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8312 [catid] => 413 [title] => DiMethyl-Histone H3-K27 Rabbit pAb [url] => /catalog/A2362 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2362 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K27 [description] => DiMethyl-Histone H3-K27 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100 [field_s8] => yes [field_s9] => DiMethyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2362_aN647(8-10)(Me)(2)_WB_01.jpg?t=1713324069|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2362_N648-4(me)_DotBlot_01.jpg?t=1713324069|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2362_N28788-5(Me)_IHC_01.jpg?t=1713324069|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2362_N28788-5(Me)_IHC_02.jpg?t=1713324069|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2362_N28788-5(Me)_IHC_03.jpg?t=1713324069|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2362_N15866-5(Me)_IF_01.jpg?t=1713324069|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2362_ChIP_01.jpg?t=1713324069 [Review] => 3 [Publication] => 2 [MoleculeName] => H3K27me2 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Lactic acid-Histone H3-K18 Rabbit pAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Lactic acid-Histone H3-K18 [_keywords] => HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, 8350, marker, Chromatin, Chromatin marker, Lactic acid-Histone H3-K18,KO/KDantibodyHIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, 8350, marker, Chromatin, Chromatin marker, Lactic acid-Histone H3-K18,PTMantibodyHIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, 8350, marker, Chromatin, Chromatin marker, Lactic acid-Histone H3-K18,小分子antibody [_Symbol] => H3C1 [_GeneID] => 8290/8350 [id] => 8376 [catid] => 1047 [title] => Lactic acid-Histone H3-K18 Rabbit pAb [url] => /catalog/A18807 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A18807 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Lactic acid-Histone H3-K18 [description] => Lactic acid-Histone H3-K18 Rabbit pAb [applications] => ELISA,DB,WB [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic lactylated peptide around K18 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:4000
WB,1:500 - 1:2000 [field_s8] => [field_s9] => [field_s10] => [field_s12] => [keywords] => HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, 8350, marker, Chromatin, Chromatin marker, Lactic acid-Histone H3-K18,KO/KD抗体HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, 8350, marker, Chromatin, Chromatin marker, Lactic acid-Histone H3-K18,PTM抗体HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, 8350, marker, Chromatin, Chromatin marker, Lactic acid-Histone H3-K18,小分子抗体 [field_l3] => APRKQ [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A18807_N10337-5(Lac)_WB_01.jpg?t=1715666641|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A18807_N10337-5(Lac)_DotBlot_01.jpg?t=1715666641 [Review] => 0 [Publication] => 2 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => citrulline-Histone H3-R2/R8/R17 Rabbit pAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; citrulline-Histone H3-R2/R8/R17 [_keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, H3R2/R8/R17, marker, Chromatin, Chromatin marker, citrulline-Histone H3-R2/R8/R17,KO/KDantibody8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, [_Symbol] => H3C1 [_GeneID] => 8290/8350 [id] => 9041 [catid] => 1047 [title] => citrulline-Histone H3-R2/R8/R17 Rabbit pAb [url] => /catalog/A18298 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A18298 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; citrulline-Histone H3-R2/R8/R17 [description] => citrulline-Histone H3-R2/R8/R17 Rabbit pAb [applications] => ELISA,DB,WB [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic citrullinated peptide around R2 & R8 & R17 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000 [field_s8] => [field_s9] => citrulline R2/R8/R17 [field_s10] => [field_s12] => [keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, H3R2/R8/R17, marker, Chromatin, Chromatin marker, citrulline-Histone H3-R2/R8/R17,KO/KD抗体8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, [field_l3] => RTKQTARKSTGGKAPR [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A18298_N16402-5(Cit)_WB_01.jpg?t=1713322656|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A18298_N16401-5(Cit)_DotBlot_01.jpg?t=1713322656 [Review] => 0 [Publication] => 2 [MoleculeName] => H3R2cit/H3R8cit/H3R17cit [recommend] => 0 [status] => 1 [Symbol] => H3C1 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Acetyl-Histone H3-K27 Rabbit pAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Acetyl-Histone H3-K27 [_keywords] => H3/A, H3C2, H3C3, H3C4, H3C6, H3C7, H3C8, H3FA, H3C10, H3C11, H3C12, HIST1H3A, marker, Chromatin, Chromatin marker, Acetyl-Histone H3-K27,KO/KDantibodyH3/A, H3C2, H3C3, H3C4, H3C6, H3C7, H3C8, H3FA, H3C10, H3C11, H3C12, HIST1H3A, marker, Chromatin, Chromatin marker, Acetyl-Histone H3-K27,PTMantibodyH3/A, H3C2, H3C3, H3C4, H3C6, H3C7, H3C8, H3FA, H3C10, H3C11, H3C12, HIST1H3A, marker, Chromatin, Chromatin marker, Acetyl-Histone H3-K27,小分子antibody [_Symbol] => H3C1 [_GeneID] => 8290/8350 [id] => 23780 [catid] => 722 [title] => Acetyl-Histone H3-K27 Rabbit pAb [url] => /catalog/A20184 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A20184 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Acetyl-Histone H3-K27 [description] => Acetyl-Histone H3-K27 Rabbit pAb [applications] => ELISA,DB,WB,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic acetylated peptide around K27 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => Acetyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => H3/A, H3C2, H3C3, H3C4, H3C6, H3C7, H3C8, H3FA, H3C10, H3C11, H3C12, HIST1H3A, marker, Chromatin, Chromatin marker, Acetyl-Histone H3-K27,KO/KD抗体H3/A, H3C2, H3C3, H3C4, H3C6, H3C7, H3C8, H3FA, H3C10, H3C11, H3C12, HIST1H3A, marker, Chromatin, Chromatin marker, Acetyl-Histone H3-K27,PTM抗体H3/A, H3C2, H3C3, H3C4, H3C6, H3C7, H3C8, H3FA, H3C10, H3C11, H3C12, HIST1H3A, marker, Chromatin, Chromatin marker, Acetyl-Histone H3-K27,小分子抗体 [field_l3] => ARKSA [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20184_N10060-5(A)_WB_01.jpg?t=1715670362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20184_N10060-5(A)_WB_02.jpg?t=1715670362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20184_N10057-8(A)_DotBlot_01.jpg?t=1715670362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20184_N13915(A)_ChIP_01.jpg?t=1715670362 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Lactic acid -Histone H4-K5 Rabbit pAb [_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Lactic acid -Histone H4-K5 [_keywords] => HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Propionyl-Histone H4-K12, 8370, Lactic acid -Histone H4-K5,KO/KDantibodyHIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Propionyl-Histone H4-K12, 8370, Lactic acid -Histone H4-K5,PTMantibodyHIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Propionyl-Histone H4-K12, 8370, Lactic acid -Histone H4-K5,小分子antibody [_Symbol] => H4C14 [_GeneID] => 8359 [id] => 14749 [catid] => 1047 [title] => Lactic acid -Histone H4-K5 Rabbit pAb [url] => /catalog/A18829 [price] => 50 μL,1180,In Stock|100 μL,1860,In Stock|200 μL,2980,In Stock [CatalogNo] => A18829 [Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; Lactic acid -Histone H4-K5 [description] => Lactic acid -Histone H4-K5 Rabbit pAb [applications] => ELISA,DB,WB [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => 14kDa [field_s4] => A synthetic lactylated peptide around K5 of human Histone H4 (NP_003539.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:4000
WB,1:500 - 1:2000 [field_s8] => [field_s9] => [field_s10] => [field_s12] => [keywords] => HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Propionyl-Histone H4-K12, 8370, Lactic acid -Histone H4-K5,KO/KD抗体HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Propionyl-Histone H4-K12, 8370, Lactic acid -Histone H4-K5,PTM抗体HIST2H4A, FO108, H4, H4/n, H4F2, H4FN, HIST2H4, histone cluster 2 H4 family member a, histone H4, H4 histone family, member N, H4 histone, family 2, histone 2, H4a, histone IV, histone cluster 2, P62805, Propionyl-Histone H4-K12, 8370, Lactic acid -Histone H4-K5,小分子抗体 [field_l3] => GRGKG [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A18829_N24570-5(Lac)_WB_01.jpg?t=1715667041|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A18829_N24570-5(Lac)_WB_02.jpg?t=1715667041|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A18829_N24570-5(Lac)_WB_03.jpg?t=1715667041|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A18829_N10341-6(Lac)_DotBlot_01.jpg?t=1715667041 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H4C14 [posid] => 0 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K27 Rabbit PolymAb® [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [_keywords] => [_Symbol] => H3C1/H3-4 [_GeneID] => 8290/8350 [id] => 43269 [catid] => 130 [title] => TriMethyl-Histone H3-K27 Rabbit PolymAb® [url] => /catalog/A25095 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A25095 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [description] => TriMethyl-Histone H3-K27 Rabbit PolymAb® [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic trimethylated peptide around K27 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IHC-P, 1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,2 μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => TriMethyl [field_s10] => [field_s12] => [keywords] => [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25095_ARC54169-02_ARC54167-02_DB_01.jpg?t=1718862666|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25095_ARC54169-02_ARC54167-02_WB_01.jpg?t=1718862666|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25095_ARC54169-02_ARC54167-02_IHC_01.jpg?t=1718862666|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25095_ARC54169-02_ARC54167-02_IHC_02.jpg?t=1718862666|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25095_ARC54169-02_ARC54167-02_IHC_03.jpg?t=1718862666|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25095_ARC54169-02_ARC54167-02_IHC_04.jpg?t=1718862666|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25095_ARC54169-02_ARC54167-02_IHC_05.jpg?t=1718862666|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25095_ARC54169-02_ARC54167-02_IF_01.jpg?t=1718862666|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25095_ARC54169-02_ARC54167-02_IF_02.jpg?t=1718862666|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A25095_ARC54169-02_ARC54167-02_ChIP_01.jpg?t=1718862666 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1/H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => pan-methyl-Histidine Rabbit pAb [_Synonyms] => [_keywords] => pan-methyl-Histidine, pan Hme, pan methyl Histidine, methyl Histidine, methyl-Histidine, pan, pan-methyl Histidine, pan methyl-Histidine,KO/KDantibodypan-methyl-Histidine, pan Hme, pan methyl Histidine, methyl Histidine, methyl-Histidine, pan, pan-methyl Histidine, pan methyl-Histidine,PTMantibodypan-methyl-Histidine, pan Hme, pan methyl Histidine, methyl Histidine, methyl-Histidine, pan, pan-methyl Histidine, pan methyl-Histidine,小分子antibody [_Symbol] => pan Methyl-Histidine [_GeneID] => [id] => 18831 [catid] => 413 [title] => pan-methyl-Histidine Rabbit pAb [url] => /catalog/A17948 [price] => 50 μL,1180,国内货期|100 μL,1860,国内货期|200 μL,2980,国内货期 [CatalogNo] => A17948 [Synonyms] => [description] => pan-methyl-Histidine Rabbit pAb [applications] => ELISA,WB,DB [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => [field_s3] => 10-100kDa [field_s4] => A synthetic peptide of Methylated Histidine His. [field_s5] => [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
DB,1:50 - 1:200 [field_s8] => [field_s9] => [field_s10] => [field_s12] => [keywords] => pan-methyl-Histidine, pan Hme, pan methyl Histidine, methyl Histidine, methyl-Histidine, pan, pan-methyl Histidine, pan methyl-Histidine,KO/KD抗体pan-methyl-Histidine, pan Hme, pan methyl Histidine, methyl Histidine, methyl-Histidine, pan, pan-methyl Histidine, pan methyl-Histidine,PTM抗体pan-methyl-Histidine, pan Hme, pan methyl Histidine, methyl Histidine, methyl-Histidine, pan, pan-methyl Histidine, pan methyl-Histidine,小分子抗体 [field_l3] => [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17948_N6638-8(Me)_WB_01.jpg?t=1697792908|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17948_N2080-10(P)_DotBlot_01.jpg?t=1697792908 [Review] => 0 [Publication] => 0 [MoleculeName] => pan Hme [recommend] => 0 [status] => 1 [Symbol] => pan Methyl-Histidine [posid] => 0 [GeneID] => Array ( [0] => ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )