我们为您找到 His 的 41 个相关产品结果。 您可以根据左侧筛选功能来找到您需要的产品。

Array ( [_title] => DiMethyl-Histone H3-K9 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K9 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K9, DiMethylHistone H3-K9, DiMethyl Histone H3-K9, H3K9me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K9, DiMethylHistone H3-K9, DiMethyl Histone H3-K9, H3K9me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, His [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8316 [catid] => 413 [title] => DiMethyl-Histone H3-K9 Rabbit pAb [url] => /catalog/A2359 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2359 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K9 [description] => DiMethyl-Histone H3-K9 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:50 - 1:200 [field_s8] => yes [field_s9] => DiMethyl K9 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K9, DiMethylHistone H3-K9, DiMethyl Histone H3-K9, H3K9me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K9, DiMethylHistone H3-K9, DiMethyl Histone H3-K9, H3K9me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, His [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N18911-5(Me)_WB_01.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_E267(Me)_DB_01.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_aN2524-8(Me)_IHC_01.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_aN2524-8(Me)_IHC_02.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N15425(Me)_IF_01.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N15425(Me)_IF_02.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N15425(Me)_IF_03.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N15425(Me)_IF_04.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N2524-5(Me)_ChIP_01.jpg?t=1715048248 [Review] => 2 [Publication] => 33 [MoleculeName] => H3K9me2 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Histone H3 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Histone H3 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, marker, Chromatin, Chromatin marker,PTMantibody [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8329 [catid] => 131 [title] => Histone H3 Rabbit pAb [url] => /catalog/A2348 [price] => 50 μL,1150,In Stock|100 μL,1870,In Stock|200 μL,2900,In Stock [CatalogNo] => A2348 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Histone H3 [description] => Histone H3 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC,IP,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 36-136 of human HIST3H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:2000 - 1:10000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
ChIP,3μg antibody for 5μg-10μg of Chromatin [field_s8] => yes [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, marker, Chromatin, Chromatin marker,PTM抗体 [field_l3] => VKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_aG307-12_WB_01.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N342_IHC_01.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N342_IHC_02.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N342_IHC_03.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N342_IHC_04.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_aG307-12_IF_01.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_aG307-12_IF_02.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N13848-6_IP_01.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N13847-6_IP_01.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N13847-6_ChIP_01.jpg?t=1715047861 [Review] => 5 [Publication] => 166 [MoleculeName] => HIST3H3 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K27 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, H [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8310 [catid] => 413 [title] => TriMethyl-Histone H3-K27 Rabbit pAb [url] => /catalog/A2363 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2363 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [description] => TriMethyl-Histone H3-K27 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC,IP,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
IP,0.5ug-4ug antibody for 400ug-600ug extracts of whole cells
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100 [field_s8] => yes [field_s9] => TriMethyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, H [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_N15995(Me)_WB_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_E1559(SMe)_DB_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_N20413-5(Me)_IHC_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_N15995-5(Me)_IF_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_aQ5382(Me)(2)_ChIP_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_N15996-5(Me)_ChIP_01.jpg?t=1715048293 [Review] => 11 [Publication] => 80 [MoleculeName] => H3K27me3 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Acetyl-Histone H3-K9 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K9 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K9, AcetylHistone H3-K9, Acetyl Histone H3-K9, H3K9ac, H3K9, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K9, AcetylHistone H3-K9, Acetyl Histone H3-K9, H3K9ac, H3K9, marker, Chromatin, Chromatin marker,PTMantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 862 [catid] => 722 [title] => Acetyl-Histone H3-K9 Rabbit pAb [url] => /catalog/A7255 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A7255 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K9 [description] => Acetyl-Histone H3-K9 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC,IP,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
IP,0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:50 [field_s8] => yes [field_s9] => Acetyl K9 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K9, AcetylHistone H3-K9, Acetyl Histone H3-K9, H3K9ac, H3K9, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K9, AcetylHistone H3-K9, Acetyl Histone H3-K9, H3K9ac, H3K9, marker, Chromatin, Chromatin marker,PTM抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_N628(8-9)(A)_WB_01.jpg?t=1716189430|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_N628(8-9)(A)_WB_02.jpg?t=1716189430|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_N628(8-9)(A)_WB_03.jpg?t=1716189430|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_Q5600(H)(A)(AX)_IHC_01.jpg?t=1716189430|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_Q5600(H)(A)(AX)_IHC_02.jpg?t=1716189430|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_Q5600(H)(A)(AX)_IHC_03.jpg?t=1716189430|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_Q5600(H)(A)(AX)_IHC_04.jpg?t=1716189430|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_N633-4(A)_IF_01.jpg?t=1716189430|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_N633-4(A)_IF_02.jpg?t=1716189430|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_aN633(A)_ChIP_01.jpg?t=1716189430 [Review] => 0 [Publication] => 69 [MoleculeName] => H3K9ac [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Acetyl-Histone H3-K27 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,PTMantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1 [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 4476 [catid] => 722 [title] => Acetyl-Histone H3-K27 Rabbit pAb [url] => /catalog/A7253 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A7253 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K27 [description] => Acetyl-Histone H3-K27 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC,IP,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:1000 - 1:5000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
IP,0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100 [field_s8] => yes [field_s9] => Acetyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,PTM抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1 [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_aN2456(10-11-12)(A)_WB_01.jpg?t=1716189015|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_aN2456(10-11-12)(A)_WB_02.jpg?t=1716189015|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_aN2455(10-11-12)(A)_IHC_01.jpg?t=1716189015|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_aN2455(10-11-12)(A)_IHC_02.jpg?t=1716189015|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_aN2455(10-11-12)(A)_IHC_03.jpg?t=1716189015|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_aN2455(10-11-12)(A)_IHC_04.jpg?t=1716189015|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_N625(H)(A)(2)_IF_01.jpg?t=1716189015|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_N625(H)(A)(2)_IF_02.jpg?t=1716189015|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_N625(H)(A)(2)_IF_03.jpg?t=1716189015|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_N15563-5(A)_ChIP_01.jpg?t=1716189015 [Review] => 1 [Publication] => 65 [MoleculeName] => H3K27ac [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Histone H3 Rabbit mAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Histone H3 [_keywords] => HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1|H3 histone family, member A|histone 1, H3a|histone H3/a|histone cluster 1, H3a, P68431, marker, Chromatin, Chromatin marker, CUT&Tag, Histone H3,KO/KDantibodyHIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1|H3 histone family, member A|histone 1, H3a|histone H3/a|histone cluster 1, H3a, P68431, marker, Chromatin, Chromatin marker, CUT&Tag, Histone H3,PTMantibody [_Symbol] => H3C1/H3-4 [_GeneID] => 8290/8350 [id] => 24080 [catid] => 130 [title] => Histone H3 Rabbit mAb [url] => /catalog/A17562 [price] => 50 μL,1200,In Stock|100 μL,2200,In Stock|200 μL,3100,In Stock [CatalogNo] => A17562 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Histone H3 [description] => Histone H3 Rabbit mAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1|H3 histone family, member A|histone 1, H3a|histone H3/a|histone cluster 1, H3a, P68431, marker, Chromatin, Chromatin marker, CUT&Tag, Histone H3,KO/KD抗体HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1|H3 histone family, member A|histone 1, H3a|histone H3/a|histone cluster 1, H3a, P68431, marker, Chromatin, Chromatin marker, CUT&Tag, Histone H3,PTM抗体 [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-01_WB_01.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-01_IHC_01.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-01_IHC_02.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-01_IHC_03.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-03_IF_03.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-03_IF_01.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-03_IF_02.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-01_ChIP_01.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-01_ChIP_02.jpg?t=1715043362 [Review] => 2 [Publication] => 11 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1/H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Acetyl-Histone H3-K27 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,PTMantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1 [_Symbol] => H3C1/H3-4 [_GeneID] => 8290/8350 [id] => 33917 [catid] => 722 [title] => Acetyl-Histone H3-K27 Rabbit mAb [url] => /catalog/A22264 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22264 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K27 [description] => Acetyl-Histone H3-K27 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic acetylated peptide around K27 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:2000 - 1:20000
WB,1:2000 - 1:20000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:50 - 1:200 [field_s8] => [field_s9] => Acetyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,PTM抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1 [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_ChIP-seq_01.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_WB_01.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_WB_02.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_WB_03.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_DotBlot_01.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_IHC_01.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_IHC_02.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_IHC_03.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-03_IF_01.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_ChIP_01.jpg?t=1715737209 [Review] => 0 [Publication] => 3 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1/H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K9 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K9 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8309 [catid] => 413 [title] => TriMethyl-Histone H3-K9 Rabbit pAb [url] => /catalog/A2360 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2360 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K9 [description] => TriMethyl-Histone H3-K9 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic trimethylated peptide around K9 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:100 - 1:500
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,2.5μg antibody for 5μg-10μg of Chromatin [field_s8] => yes [field_s9] => TriMethyl K9 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [field_l3] => ARKST [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N10094-5(Me)_WB_01.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_E269(Me)_DB_01.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N576(H)(Me)(AX)_IHC_01.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N576(H)(Me)(AX)_IHC_02.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15432-5(Me)_IF_01.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15432-5(Me)_IF_02.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15432-5(Me)_IF_03.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15432-5(Me)_IF_04.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15832-5(Me)_ChIP_01.jpg?t=1715048268 [Review] => 6 [Publication] => 49 [MoleculeName] => H3K9me3 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Acetyl-Histone H3-K27 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,PTMantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,小分子antibody [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 33520 [catid] => 722 [title] => Acetyl-Histone H3-K27 Rabbit mAb [url] => /catalog/A22077 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22077 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K27 [description] => Acetyl-Histone H3-K27 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,ChIP-seq,CUT&Tag [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => Refer to figures [field_s4] => A synthetic acetylated peptide around K27 of human Acetyl-Histone H3-K27 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:2000 - 1:20000
WB,1:2000 - 1:20000
IHC-P,1:50 - 1:200
IF,1:100 - 1:500
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:50 - 1:200
CUT&Tag, 10⁵ cells /1 μg [field_s8] => [field_s9] => Acetyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,PTM抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,小分子抗体 [field_l3] => AARKS [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22077_ARC53671-01_ChIP-seq_01.jpg?t=1718353284|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22077_ARC53671-01_ChIP-seq_02.jpg?t=1718353284|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22077_ARC53671-01_WB_01.jpg?t=1718353284|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22077_ARC53671-01_DotBlot_01.jpg?t=1718353284|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22077_ARC53671-01_IHC_01.jpg?t=1718353284|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22077_ARC53671-01_IHC_02.jpg?t=1718353284|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22077_ARC53671-01_IF_01.jpg?t=1718353284|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22077_ARC53671-01_ChIP_01.jpg?t=1718353284 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H3-K4 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K4 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histo [_Symbol] => H3C1/H3-4 [_GeneID] => 8290/8350 [id] => 33095 [catid] => 413 [title] => MonoMethyl-Histone H3-K4 Rabbit mAb [url] => /catalog/A22078 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22078 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K4 [description] => MonoMethyl-Histone H3-K4 Rabbit mAb [applications] => ELISA,DB,WB,IF/ICC,CUT&Tag [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic monomethylated peptide around K4 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:1000 - 1:5000
WB,1:2000 - 1:20000
IF/ICC,1:100 - 1:500
CUT&Tag, 10⁵ cells /1 μg [field_s8] => [field_s9] => MonoMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histo [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22078_ARC54646-01(1比1)_ChIP-seq_01.jpg?t=1713323299|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22078_ARC54646-01(1比1)_WB_01.jpg?t=1713323299|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22078_ARC54646-01(1比1)_DotBlot_01.jpg?t=1713323299|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22078_ARC54646-01(1比1)_IF_01.jpg?t=1713323299|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22078_ARC54646-01(1比1)_IF_02.jpg?t=1713323299|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22078_ARC54646-01(1比1)_IF_03.jpg?t=1713323299|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22078_ARC54646-01(2比3)_IF_01.jpg?t=1713323299 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1/H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Phospho-Histone H3-T11 Rabbit mAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Phospho-Histone H3-S10 [_keywords] => [_Symbol] => H3C1/H3-4 [_GeneID] => 8290/8350 [id] => 44017 [catid] => 414 [title] => Phospho-Histone H3-T11 Rabbit mAb [url] => /catalog/AP1472 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => AP1472 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Phospho-Histone H3-S10 [description] => Phospho-Histone H3-T11 Rabbit mAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic phosphorylated peptide around T11 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:2000 - 1:6000
IHC-P,1:100-1:500
IF/ICC,1:100 - 1:500
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => Phospho T11 [field_s10] => Unconjugated [field_s12] => [keywords] => [field_l3] => KSTGG [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP1472_ARC61334-01_WB_01.jpg?t=1716429737|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP1472_ARC61334-01_WB_02.jpg?t=1716429737|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP1472_ARC61334-01_IHC_01.jpg?t=1716429737|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP1472_ARC61334-01_IHC_02.jpg?t=1716429737|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP1472_ARC61334-01_IF_01.jpg?t=1716429737|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP1472_ARC61334-01_ChIP_02.jpg?t=1716429737 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1/H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K27 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, H [_Symbol] => H3C1/H3-4 [_GeneID] => 8290/8350 [id] => 33206 [catid] => 413 [title] => TriMethyl-Histone H3-K27 Rabbit mAb [url] => /catalog/A22006 [price] => 50 μL,1600,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22006 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [description] => TriMethyl-Histone H3-K27 Rabbit mAb [applications] => ELISA,DB,WB,IF/ICC,IP,ChIP,CUT&Tag [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kd [field_s4] => A synthetic trimethylated peptide around K27 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:2000 - 1:20000
WB,1:10000 - 1:160000
IF/ICC,1:500 - 1:1000
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
ChIP,5μg antibody for 5μg-10μg of Chromatin
CUT&Tag, 10⁵ cells /1 μg [field_s8] => [field_s9] => TriMethyl K27 [field_s10] => [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, H [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22006_ARC54169-02_cut-tag_01.jpg?t=1713255154|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22006_ARC54169-02_cut-tag_02.jpg?t=1713255154|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22006_ARC54169-01_WB_01.jpg?t=1713255154|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22006_ARC54169-01_IF_01.jpg?t=1713255154|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22006_ARC54169-01_IF_02.jpg?t=1713255154|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22006_ARC54169-02_IP_01.jpg?t=1713255154|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22006_ARC54169-01_ChIP_01.jpg?t=1713255154 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1/H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K27 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, H [_Symbol] => H3C1/H3-4 [_GeneID] => 8290/8350 [id] => 34064 [catid] => 413 [title] => TriMethyl-Histone H3-K27 Rabbit mAb [url] => /catalog/A22396 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22396 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [description] => TriMethyl-Histone H3-K27 Rabbit mAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP,CUT&Tag [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic trimethylated peptide around K27 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:10000 - 1:160000
IHC-P,1:500 - 1:1000
IF/ICC,1:500 - 1:1000
ChIP,5μg antibody for 5μg-10μg of Chromatin
CUT&Tag, 10⁵ cells /1 μg [field_s8] => [field_s9] => TriMethyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, H [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22396_ARC54167-01_ChIP-seq_01.jpg?t=1715046315|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22396_ARC54167-01_WB_01.jpg?t=1715046315|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22396_ARC54167-01_IHC_01.jpg?t=1715046315|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22396_ARC54167-01_IHC_02.jpg?t=1715046315|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22396_ARC54167-01_IF_01.jpg?t=1715046315|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22396_ARC54167-01_ChIP_01.jpg?t=1715046315 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1/H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => MonoMethyl-Histone H3-K4 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K4 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histo [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8321 [catid] => 413 [title] => MonoMethyl-Histone H3-K4 Rabbit pAb [url] => /catalog/A2355 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2355 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K4 [description] => MonoMethyl-Histone H3-K4 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic monomethylated peptide around K4 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100 [field_s8] => yes [field_s9] => MonoMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histo [field_l3] => RTKQT [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_aN551(14-15)(Me)_WB_01.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_E451(Me)(2)_DB_01.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_MP50519-03_IHC_01.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_MP50519-03_IHC_02.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_MP50519-03_IHC_03.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_N551-9(Me)_IF_01.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_N10017(Me)_IF_01.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_N10017(Me)_IF_02.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_N10017(Me)_IF_03.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_N20433-5(Me)_IF_01.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_N20433-5(Me)_IF_02.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_E450(Me)(2)_ChIP_01.jpg?t=1713323963|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2355_N17149-5(Me)_ChIP_01.jpg?t=1713323963 [Review] => 3 [Publication] => 37 [MoleculeName] => H3K4me1 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Acetyl-Histone H3-K14 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K14 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K14, AcetylHistone H3-K14, Acetyl Histone H3-K14, H3K14ac, H3K14, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K14, AcetylHistone H3-K14, Acetyl Histone H3-K14, H3K14ac, H3K14, marker, Chromatin, Chromatin marker,PTMantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1 [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 4480 [catid] => 722 [title] => Acetyl-Histone H3-K14 Rabbit pAb [url] => /catalog/A7254 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A7254 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K14 [description] => Acetyl-Histone H3-K14 Rabbit pAb [applications] => ELISA,WB,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic acetylated peptide around K14 of human H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => Acetyl K14 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K14, AcetylHistone H3-K14, Acetyl Histone H3-K14, H3K14ac, H3K14, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K14, AcetylHistone H3-K14, Acetyl Histone H3-K14, H3K14ac, H3K14, marker, Chromatin, Chromatin marker,PTM抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1 [field_l3] => GGKAP [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7254_N14121(A)_WB_01.jpg?t=1718354328|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7254_N14121(A)_WB_02.jpg?t=1718354328|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7254_N14121(A)_WB_03.jpg?t=1718354328|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7254_N2446-5(A)_IF_01.jpg?t=1718354328 [Review] => 1 [Publication] => 30 [MoleculeName] => H3K14ac [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )