Array
(
[_title] => DiMethyl-Histone H3-K9 Rabbit pAb
[_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K9
[_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K9, DiMethylHistone H3-K9, DiMethyl Histone H3-K9, H3K9me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K9, DiMethylHistone H3-K9, DiMethyl Histone H3-K9, H3K9me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, His
[_Symbol] => H3-4
[_GeneID] => 8290/8350
[id] => 8316
[catid] => 413
[title] => DiMethyl-Histone H3-K9 Rabbit pAb
[url] => /catalog/A2359
[price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock
[CatalogNo] => A2359
[Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K9
[description] => DiMethyl-Histone H3-K9 Rabbit pAb
[applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,ChIP-seq
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 16kDa
[field_s3] => 17kDa
[field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:50 - 1:200
[field_s8] => yes
[field_s9] => DiMethyl K9
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K9, DiMethylHistone H3-K9, DiMethyl Histone H3-K9, H3K9me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K9, DiMethylHistone H3-K9, DiMethyl Histone H3-K9, H3K9me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, His
[field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N18911-5(Me)_WB_01.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_E267(Me)_DB_01.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_aN2524-8(Me)_IHC_01.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_aN2524-8(Me)_IHC_02.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N15425(Me)_IF_01.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N15425(Me)_IF_02.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N15425(Me)_IF_03.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N15425(Me)_IF_04.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N2524-5(Me)_ChIP_01.jpg?t=1715048248
[Review] => 2
[Publication] => 33
[MoleculeName] => H3K9me2
[recommend] => 0
[status] => 1
[Symbol] => H3-4
[posid] => 1
[GeneID] => Array
(
[0] => 8290
[1] => 8350
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 111
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => TriMethyl-Histone H3-K27 Rabbit pAb
[_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27
[_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, H
[_Symbol] => H3-4
[_GeneID] => 8290/8350
[id] => 8310
[catid] => 413
[title] => TriMethyl-Histone H3-K27 Rabbit pAb
[url] => /catalog/A2363
[price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock
[CatalogNo] => A2363
[Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27
[description] => TriMethyl-Histone H3-K27 Rabbit pAb
[applications] => ELISA,WB,IHC-P,IF/ICC,IP,ChIP,ChIP-seq
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 16kDa
[field_s3] => 17kDa
[field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
IP,0.5ug-4ug antibody for 400ug-600ug extracts of whole cells
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100
[field_s8] => yes
[field_s9] => TriMethyl K27
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, H
[field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_N15995(Me)_WB_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_E1559(SMe)_DB_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_N20413-5(Me)_IHC_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_N15995-5(Me)_IF_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_aQ5382(Me)(2)_ChIP_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_N15996-5(Me)_ChIP_01.jpg?t=1715048293
[Review] => 11
[Publication] => 80
[MoleculeName] => H3K27me3
[recommend] => 0
[status] => 1
[Symbol] => H3-4
[posid] => 1
[GeneID] => Array
(
[0] => 8290
[1] => 8350
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 111
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => TriMethyl-Histone H3-K4 Rabbit mAb
[_Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4
[_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/
[_Symbol] => Histone H3
[_GeneID] => 8290/8350
[id] => 33518
[catid] => 413
[title] => TriMethyl-Histone H3-K4 Rabbit mAb
[url] => /catalog/A22146
[price] => 50 μL,1600,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock
[CatalogNo] => A22146
[Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4
[description] => TriMethyl-Histone H3-K4 Rabbit mAb
[applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,CUT&Tag,ChIP-seq
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 15kDa
[field_s3] => 17kDa
[field_s4] => A synthetic trimethylated peptide around K4 of human Histone H3 (NP_003520.1).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => DB,1:10000 - 1:60000
WB,1:10000- 1:60000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
CUT&Tag, 10⁵ cells /1 μg
ChIP-seq,1:50 - 1:200
[field_s8] =>
[field_s9] => TriMethyl K4
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/
[field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_ChIP-seq_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_ChIP-seq_02.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_WB_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_DotBlot_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IHC_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IHC_02.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IHC_03.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IF_03.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IF_02.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IF_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_ChIP_01.jpg?t=1715045739
[Review] => 0
[Publication] => 2
[MoleculeName] =>
[recommend] => 0
[status] => 1
[Symbol] => Histone H3
[posid] => 0
[GeneID] => Array
(
[0] => 8290
[1] => 8350
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 110
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => TriMethyl-Histone H3-K9 Rabbit pAb
[_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K9
[_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/
[_Symbol] => H3-4
[_GeneID] => 8290/8350
[id] => 8309
[catid] => 413
[title] => TriMethyl-Histone H3-K9 Rabbit pAb
[url] => /catalog/A2360
[price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock
[CatalogNo] => A2360
[Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K9
[description] => TriMethyl-Histone H3-K9 Rabbit pAb
[applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 16kDa
[field_s3] => 17kDa
[field_s4] => A synthetic trimethylated peptide around K9 of human histone H3 (NP_003520.1).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => DB,1:500 - 1:2000
WB,1:100 - 1:500
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,2.5μg antibody for 5μg-10μg of Chromatin
[field_s8] => yes
[field_s9] => TriMethyl K9
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/
[field_l3] => ARKST
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N10094-5(Me)_WB_01.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_E269(Me)_DB_01.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N576(H)(Me)(AX)_IHC_01.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N576(H)(Me)(AX)_IHC_02.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15432-5(Me)_IF_01.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15432-5(Me)_IF_02.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15432-5(Me)_IF_03.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15432-5(Me)_IF_04.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15832-5(Me)_ChIP_01.jpg?t=1715048268
[Review] => 6
[Publication] => 49
[MoleculeName] => H3K9me3
[recommend] => 0
[status] => 1
[Symbol] => H3-4
[posid] => 1
[GeneID] => Array
(
[0] => 8290
[1] => 8350
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 111
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => DiMethyl-Histone H3-K4 Rabbit mAb
[_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K4
[_keywords] =>
[_Symbol] => Histone H3
[_GeneID] => 8290/8350
[id] => 4500
[catid] => 413
[title] => DiMethyl-Histone H3-K4 Rabbit mAb
[url] => /catalog/A22143
[price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock
[CatalogNo] => A22143
[Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K4
[description] => DiMethyl-Histone H3-K4 Rabbit mAb
[applications] => ELISA,DB,WB,IHC-P,IF/ICC,IP,ChIP,ChIP-seq,CUT&Tag
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 16kDa
[field_s3] => 17kDa
[field_s4] => A synthetic dimethylated peptide around K4 of human Histone H3 (NP_003520.1).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => DB,1:2000 - 1:6000
WB,1:1000 - 1:5000
IHC-P,1:1000 - 1:5000
IF/ICC,1:50 - 1:200
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:50 - 1:200
CUT&Tag,10⁵ cells /1 μg
[field_s8] =>
[field_s9] => DiMethyl K4
[field_s10] => Unconjugated
[field_s12] =>
[keywords] =>
[field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_ChIP-seq_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_cut-tag_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_WB_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_DotBlot_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_02.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_03.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_04.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_05.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IF_02.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IP_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_ChIP_01.jpg?t=1713324352
[Review] => 0
[Publication] => 1
[MoleculeName] =>
[recommend] => 0
[status] => 1
[Symbol] => Histone H3
[posid] => 0
[GeneID] => Array
(
[0] => 8290
[1] => 8350
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 110
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => TriMethyl-Histone H3-K4 Rabbit mAb
[_Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4
[_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/
[_Symbol] => Histone H3
[_GeneID] => 8290/8350
[id] => 33674
[catid] => 413
[title] => TriMethyl-Histone H3-K4 Rabbit mAb
[url] => /catalog/A22225
[price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock
[CatalogNo] => A22225
[Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4
[description] => TriMethyl-Histone H3-K4 Rabbit mAb
[applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 15kDa
[field_s3] => 17kDa
[field_s4] => A synthetic trimethylated peptide around K4 of human Histone H3 (NP_003520.1).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => DB,1:10000 - 1:60000
WB,1:10000 - 1:30000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
[field_s8] =>
[field_s9] => TriMethyl K4
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/
[field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_WB_01.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_DotBlot_01.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_IHC_01.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_IHC_02.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_IHC_03.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_IF_01.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_ChIP_01.jpg?t=1715045863
[Review] => 0
[Publication] => 1
[MoleculeName] =>
[recommend] => 0
[status] => 1
[Symbol] => Histone H3
[posid] => 0
[GeneID] => Array
(
[0] => 8290
[1] => 8350
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 110
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => DiMethyl-Histone H3-K36 Rabbit mAb
[_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K36
[_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker, DiMethyl-Histone H3-K36,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histon
[_Symbol] => Histone H3
[_GeneID] => 8290/8350
[id] => 33464
[catid] => 413
[title] => DiMethyl-Histone H3-K36 Rabbit mAb
[url] => /catalog/A22087
[price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock
[CatalogNo] => A22087
[Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K36
[description] => DiMethyl-Histone H3-K36 Rabbit mAb
[applications] => ELISA,DB,WB,IHC-P,IF/ICC,IP
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 16kDa
[field_s3] => 17kDa
[field_s4] => A synthetic dimethylated peptide around K36 of human Histone H3 (NP_003520.1).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => DB,1:2000 - 1:10000
WB,1:2000 - 1:10000
IHC-P,1:1000 - 1:5000
IF/ICC,1:50 - 1:200
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
[field_s8] =>
[field_s9] => DiMethyl K36
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker, DiMethyl-Histone H3-K36,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histon
[field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_WB_01.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_DotBlot_01.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_01.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_02.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_03.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_04.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_05.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_06.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_07.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_08.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IF_01.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IF_02.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IP_01.jpg?t=1713323345
[Review] => 0
[Publication] => 0
[MoleculeName] =>
[recommend] => 0
[status] => 1
[Symbol] => Histone H3
[posid] => 0
[GeneID] => Array
(
[0] => 8290
[1] => 8350
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 110
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => DiMethyl-Histone H3-K79 Rabbit mAb
[_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K79
[_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker, DiMethyl-Histone H3-K79,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histon
[_Symbol] => Histone H3
[_GeneID] => 8290/8350
[id] => 33463
[catid] => 413
[title] => DiMethyl-Histone H3-K79 Rabbit mAb
[url] => /catalog/A22086
[price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock
[CatalogNo] => A22086
[Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K79
[description] => DiMethyl-Histone H3-K79 Rabbit mAb
[applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,IP,ChIP-seq
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 16kDa
[field_s3] => 17kDa
[field_s4] => A synthetic dimethylated peptide around K79 of human Histone H3-K79 (NP_003520.1).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => DB,1:2000 - 1:20000
WB,1:2000 - 1:20000
IHC-P,1:500 - 1:1000
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
ChIP-seq,1:50 - 1:200
[field_s8] =>
[field_s9] => DiMethyl K79
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker, DiMethyl-Histone H3-K79,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histon
[field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_ChIP-seq_01.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_WB_01.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_DotBlot_01.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IHC_05.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IHC_03.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IHC_01.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IHC_02.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IHC_04.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IHC_06.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IF_03.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IF_04.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IP_01.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_ChIP_01.jpg?t=1713323323
[Review] => 0
[Publication] => 0
[MoleculeName] =>
[recommend] => 0
[status] => 1
[Symbol] => Histone H3
[posid] => 0
[GeneID] => Array
(
[0] => 8290
[1] => 8350
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 110
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => DiMethyl-Histone H4-K20 Rabbit mAb
[_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; DiMethyl-Histone H4-K20
[_keywords] => H4, H4/n, H4C1, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2, H4FN, FO108, H4-16, H4C11, H4C12, H4C13, H4C15, HIST2H4, HIST2H4A, DiMethyl-Histone H4-K20,KO/KDantibodyH4, H4/n, H4C1, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2, H4FN, FO108, H4-16, H4C11, H4C12, H4C13, H4C15, HIST2H4, HIST2H4A, DiMethyl-Histone H4-K20,PTMantibodyH4, H4/n, H4C1, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2, H4FN, FO108, H4-16, H4C11, H4C12, H4C13, H4C15, HIST2H4, HIST2H4A, DiMethyl-Histone H4-K20,小分子antibody
[_Symbol] => Histone H4
[_GeneID] => 8359
[id] => 33921
[catid] => 413
[title] => DiMethyl-Histone H4-K20 Rabbit mAb
[url] => /catalog/A22268
[price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock
[CatalogNo] => A22268
[Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; DiMethyl-Histone H4-K20
[description] => DiMethyl-Histone H4-K20 Rabbit mAb
[applications] => ELISA,DB,WB,IHC-P,IF/ICC
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 11kDa
[field_s3] => 11kDa
[field_s4] => A synthetic dimethylated peptide around K20 of human Histone H4 (NP_003539.1).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IHC-P,1:500 - 1:1000
IF/ICC,1:500 - 1:1000
[field_s8] =>
[field_s9] => DiMethyl K20
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => H4, H4/n, H4C1, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2, H4FN, FO108, H4-16, H4C11, H4C12, H4C13, H4C15, HIST2H4, HIST2H4A, DiMethyl-Histone H4-K20,KO/KD抗体H4, H4/n, H4C1, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2, H4FN, FO108, H4-16, H4C11, H4C12, H4C13, H4C15, HIST2H4, HIST2H4A, DiMethyl-Histone H4-K20,PTM抗体H4, H4/n, H4C1, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2, H4FN, FO108, H4-16, H4C11, H4C12, H4C13, H4C15, HIST2H4, HIST2H4A, DiMethyl-Histone H4-K20,小分子抗体
[field_l3] => MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22268_ARC55058-01_WB_01.jpg?t=1715045945|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22268_ARC55058-01_DotBlot_01.jpg?t=1715045945|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22268_ARC55058-01_IHC_01.jpg?t=1715045945|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22268_ARC55058-01_IHC_02.jpg?t=1715045945|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22268_ARC55058-01_IHC_03.jpg?t=1715045945|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22268_ARC55058-01_IF_01.jpg?t=1715045945
[Review] => 0
[Publication] => 0
[MoleculeName] =>
[recommend] => 0
[status] => 1
[Symbol] => Histone H4
[posid] => 0
[GeneID] => Array
(
[0] => 8359
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 110
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => MonoMethyl-Histone H3-K18 Rabbit mAb
[_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K18
[_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker, MonoMethyl-Histone H3-K18,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histon
[_Symbol] => Histone H3
[_GeneID] => 8290/8350
[id] => 30847
[catid] => 413
[title] => MonoMethyl-Histone H3-K18 Rabbit mAb
[url] => /catalog/A20680
[price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock
[CatalogNo] => A20680
[Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K18
[description] => MonoMethyl-Histone H3-K18 Rabbit mAb
[applications] => ELISA,DB,WB,IHC-P,IP,IF/ICC,ChIP,CUT&Tag
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 16kDa
[field_s3] => 17kDa
[field_s4] => A synthetic monomethylated peptide around K18 of human histone H3 (P68431).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
CUT&Tag, 10⁵ cells /1 μg
[field_s8] =>
[field_s9] => MonoMethyl K9
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker, MonoMethyl-Histone H3-K18,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histon
[field_l3] => APRKQ
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_ChIP-seq_01.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_WB_01.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_DotBlot_01.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_IHC_01.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_IHC_02.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_IHC_03.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_IF_01.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_IF_02.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_IP_01.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_ChIP_01.jpg?t=1714989343
[Review] => 0
[Publication] => 0
[MoleculeName] =>
[recommend] => 0
[status] => 1
[Symbol] => Histone H3
[posid] => 0
[GeneID] => Array
(
[0] => 8290
[1] => 8350
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 110
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => MonoMethyl-Histone H3-K27 Rabbit mAb
[_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K27
[_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3
[_Symbol] => Histone H3
[_GeneID] => 8290/8350
[id] => 33616
[catid] => 413
[title] => MonoMethyl-Histone H3-K27 Rabbit mAb
[url] => /catalog/A22170
[price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock
[CatalogNo] => A22170
[Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K27
[description] => MonoMethyl-Histone H3-K27 Rabbit mAb
[applications] => ELISA,DB,WB,IF/ICC
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 16kDa
[field_s3] => 17kDa
[field_s4] => A synthetic monomethylated peptide around K27 of human Histone H3 (NP_003520.1).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => DB,1:10000 - 1:30000
WB,1:10000 - 1:30000
IF/ICC,1:50 - 1:200
[field_s8] =>
[field_s9] => MonoMethyl K27
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K27, MonoMethylHistone H3-K27, MonoMethyl Histone H3-K27, H3K27me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3
[field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22170_ARC55261-01_WB_01.jpg?t=1713323472|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22170_ARC55261-01_WB_02.jpg?t=1713323472|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22170_ARC55261-01_DotBlot_01.jpg?t=1713323472|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22170_ARC55261-01_IF_01.jpg?t=1713323472|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22170_ARC55261-01_IF_02.jpg?t=1713323472
[Review] => 0
[Publication] => 0
[MoleculeName] =>
[recommend] => 0
[status] => 1
[Symbol] => Histone H3
[posid] => 0
[GeneID] => Array
(
[0] => 8290
[1] => 8350
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 110
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => MonoMethyl-Histone H3-K4 Rabbit mAb
[_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K4
[_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histo
[_Symbol] => H3C1/H3-4
[_GeneID] => 8290/8350
[id] => 33095
[catid] => 413
[title] => MonoMethyl-Histone H3-K4 Rabbit mAb
[url] => /catalog/A22078
[price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock
[CatalogNo] => A22078
[Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K4
[description] => MonoMethyl-Histone H3-K4 Rabbit mAb
[applications] => ELISA,DB,WB,IF/ICC,CUT&Tag
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 16kDa
[field_s3] => 17kDa
[field_s4] => A synthetic monomethylated peptide around K4 of human Histone H3 (NP_003520.1).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => DB,1:1000 - 1:5000
WB,1:2000 - 1:20000
IF/ICC,1:100 - 1:500
CUT&Tag, 10⁵ cells /1 μg
[field_s8] =>
[field_s9] => MonoMethyl K4
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histo
[field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22078_ARC54646-01(1比1)_ChIP-seq_01.jpg?t=1713323299|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22078_ARC54646-01(1比1)_WB_01.jpg?t=1713323299|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22078_ARC54646-01(1比1)_DotBlot_01.jpg?t=1713323299|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22078_ARC54646-01(1比1)_IF_01.jpg?t=1713323299|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22078_ARC54646-01(1比1)_IF_02.jpg?t=1713323299|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22078_ARC54646-01(1比1)_IF_03.jpg?t=1713323299|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22078_ARC54646-01(2比3)_IF_01.jpg?t=1713323299
[Review] => 0
[Publication] => 0
[MoleculeName] =>
[recommend] => 0
[status] => 1
[Symbol] => H3C1/H3-4
[posid] => 0
[GeneID] => Array
(
[0] => 8290
[1] => 8350
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 110
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => MonoMethyl-Histone H3-K9 Rabbit mAb
[_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K9
[_keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, Unmodified, H3K79, marker, Chromatin, Chromatin marker, MonoMethyl-Histone H3-K9,KO/KDantibody8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, H
[_Symbol] => Histone H3
[_GeneID] => 8290/8350
[id] => 30981
[catid] => 413
[title] => MonoMethyl-Histone H3-K9 Rabbit mAb
[url] => /catalog/A20734
[price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock
[CatalogNo] => A20734
[Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; MonoMethyl-Histone H3-K9
[description] => MonoMethyl-Histone H3-K9 Rabbit mAb
[applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,CUT&Tag
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 16kDa
[field_s3] => 17kDa
[field_s4] => A synthetic monomethylated peptide around K9 of human Histone H3 (P68431).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IHC-P,1:500 - 1:1000
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
CUT&Tag, 10⁵ cells /1 μg
[field_s8] =>
[field_s9] => MonoMethyl K9
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, Unmodified, H3K79, marker, Chromatin, Chromatin marker, MonoMethyl-Histone H3-K9,KO/KD抗体8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, H
[field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_ChIP-seq_01.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_WB_01.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_DotBlot_01.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_01.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_02.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_03.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_04.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_05.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_06.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_07.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_08.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_09.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_10.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_11.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IHC_12.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_IF_01.jpg?t=1713322990|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20734_ARC2677_ChIP_01.jpg?t=1713322990
[Review] => 0
[Publication] => 0
[MoleculeName] =>
[recommend] => 0
[status] => 1
[Symbol] => Histone H3
[posid] => 0
[GeneID] => Array
(
[0] => 8290
[1] => 8350
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 110
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => MonoMethyl-Histone H3-K9 Rabbit mAb
[_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K9
[_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker, MonoMethyl-Histone H3-K9,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone
[_Symbol] => Histone H3
[_GeneID] => 8290/8350
[id] => 33414
[catid] => 413
[title] => MonoMethyl-Histone H3-K9 Rabbit mAb
[url] => /catalog/A22079
[price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock
[CatalogNo] => A22079
[Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K9
[description] => MonoMethyl-Histone H3-K9 Rabbit mAb
[applications] => ELISA,WB,IHC-P,IF/ICC,ChIP,DB
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 16kDa
[field_s3] => 17kDa
[field_s4] => A synthetic monomethylated peptide around K9 of human Histone H3 (NP_003520.1).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => WB,1:1000 - 1:5000
IHC-P,1:100 - 1:500
IF/ICC,1:50 - 1:200
DB,1:1000 - 1:5000
[field_s8] =>
[field_s9] => MonoMethyl K9
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker, MonoMethyl-Histone H3-K9,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K4, MonoMethylHistone H3-K4, MonoMethyl Histone H3-K4, H3K4me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone
[field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22079_ARC54621-01(1比1)_WB_01.jpg?t=1715045601|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22079_ARC54621-01(1比1)_DotBlot_01.jpg?t=1715045601|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22079_ARC54621-01(1比1)_IHC_01.jpg?t=1715045601|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22079_ARC54621-01(1比1)_IHC_02.jpg?t=1715045601|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22079_ARC54621-01(1比1)_IHC_03.jpg?t=1715045601|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22079_ARC54621-01(1比1)_IHC_04.jpg?t=1715045601|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22079_ARC54621-01(1比1)_IF_01.jpg?t=1715045601|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22079_ARC54621-01(1比1)_IF_02.jpg?t=1715045601|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22079_ARC54621-01(1比1)_IF_03.jpg?t=1715045601
[Review] => 0
[Publication] => 0
[MoleculeName] =>
[recommend] => 0
[status] => 1
[Symbol] => Histone H3
[posid] => 0
[GeneID] => Array
(
[0] => 8290
[1] => 8350
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 110
[datasheet] =>
[validation] => 0
[status_cn] => 1
)
Array
(
[_title] => Symmetric DiMethyl-Histone H3-R8 Rabbit mAb
[_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Symmetric DiMethyl-Histone H3-R8
[_keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, Asymmetric DiMethyl R17, H3R17, marker, Chromatin, Chromatin marker, Symmetric DiMethyl-Histone H3-R8,KO/KDantibody8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone
[_Symbol] => Histone H3
[_GeneID] => 8290/8350
[id] => 31321
[catid] => 413
[title] => Symmetric DiMethyl-Histone H3-R8 Rabbit mAb
[url] => /catalog/A21207
[price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock
[CatalogNo] => A21207
[Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Symmetric DiMethyl-Histone H3-R8
[description] => Symmetric DiMethyl-Histone H3-R8 Rabbit mAb
[applications] => ELISA,WB,DB,IHC-P,IF/ICC
[Species] => Rabbit
[field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted)
[field_s2] => 16kDa
[field_s3] => 17kDa
[field_s4] => A synthetic symmetric dimethylated peptide around R8 of human Histone H3 (NP_003520.1).
[field_s5] => Human
[field_s6] => IgG
[field_s7] => DB,1:10000 - 1:120000
WB,1:2000 - 1:10000
IHC-P,1:500 - 1:1000
IF/ICC,1:50 - 1:200
[field_s8] =>
[field_s9] => Symmetric DiMethyl R8
[field_s10] => Unconjugated
[field_s12] =>
[keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, Asymmetric DiMethyl R17, H3R17, marker, Chromatin, Chromatin marker, Symmetric DiMethyl-Histone H3-R8,KO/KD抗体8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone
[field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
[pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21207_ARC53358-01_WB_01.jpg?t=1714990252|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21207_ARC53358-01_DotBlot_01.jpg?t=1714990252|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21207_ARC53358-01_IHC_01.jpg?t=1714990252|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21207_ARC53358-01_IHC_02.jpg?t=1714990252|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21207_ARC53358-01_IHC_03.jpg?t=1714990252|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21207_ARC53358-01_IF_01.jpg?t=1714990252|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A21207_ARC53358-01_IF_02.jpg?t=1714990252
[Review] => 0
[Publication] => 0
[MoleculeName] =>
[recommend] => 0
[status] => 1
[Symbol] => Histone H3
[posid] => 0
[GeneID] => Array
(
[0] => 8290
[1] => 8350
)
[field_l6] =>
[readgroup] =>
[sbu_code] => 110
[datasheet] =>
[validation] => 0
[status_cn] => 1
)