首页 / 搜索结果

我们为您找到 His 的 49 个相关产品结果。

在结果中进一步筛选

抗体产品
更多收起
特色产品
更多收起
靶点
更多收起
反应物种
更多收起多选
应用
更多收起多选
Array ( [_title] => DiMethyl-Histone H3-K9 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K9 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K9, DiMethylHistone H3-K9, DiMethyl Histone H3-K9, H3K9me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K9, DiMethylHistone H3-K9, DiMethyl Histone H3-K9, H3K9me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, His [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8316 [catid] => 413 [title] => DiMethyl-Histone H3-K9 Rabbit pAb [url] => /catalog/A2359 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2359 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K9 [description] => DiMethyl-Histone H3-K9 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:50 - 1:200 [field_s8] => yes [field_s9] => DiMethyl K9 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K9, DiMethylHistone H3-K9, DiMethyl Histone H3-K9, H3K9me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K9, DiMethylHistone H3-K9, DiMethyl Histone H3-K9, H3K9me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, His [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N18911-5(Me)_WB_01.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_E267(Me)_DB_01.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_aN2524-8(Me)_IHC_01.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_aN2524-8(Me)_IHC_02.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N15425(Me)_IF_01.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N15425(Me)_IF_02.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N15425(Me)_IF_03.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N15425(Me)_IF_04.jpg?t=1715048248|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2359_N2524-5(Me)_ChIP_01.jpg?t=1715048248 [Review] => 2 [Publication] => 33 [MoleculeName] => H3K9me2 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

DiMethyl-Histone H3-K9 Rabbit pAb

Catalog:A2359

GeneID:82908350

Application:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC (intra)ELISA(ELISA)MeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Synonyms:H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K9

Type:Rabbit Polyclonal Antibody

Array ( [_title] => TriMethyl-Histone H3-K27 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, H [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8310 [catid] => 413 [title] => TriMethyl-Histone H3-K27 Rabbit pAb [url] => /catalog/A2363 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2363 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [description] => TriMethyl-Histone H3-K27 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC,IP,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
IP,0.5ug-4ug antibody for 400ug-600ug extracts of whole cells
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100 [field_s8] => yes [field_s9] => TriMethyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, H [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_N15995(Me)_WB_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_E1559(SMe)_DB_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_N20413-5(Me)_IHC_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_N15995-5(Me)_IF_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_aQ5382(Me)(2)_ChIP_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_N15996-5(Me)_ChIP_01.jpg?t=1715048293 [Review] => 11 [Publication] => 80 [MoleculeName] => H3K27me3 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

TriMethyl-Histone H3-K27 Rabbit pAb

Catalog:A2363

GeneID:82908350

Application:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC (intra)ELISA(ELISA)MeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Synonyms:H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27

Type:Rabbit Polyclonal Antibody

Array ( [_title] => TriMethyl-Histone H3-K4 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K4 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8318 [catid] => 413 [title] => TriMethyl-Histone H3-K4 Rabbit pAb [url] => /catalog/A2357 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2357 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K4 [description] => TriMethyl-Histone H3-K4 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa/ [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:100 - 1:500
IHC-P,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100 [field_s8] => yes [field_s9] => TriMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2357_N20423-6(Me)_WB_01.jpg?t=1718074106|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2357_N20423-6(Me)_WB_02.jpg?t=1718074106|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2357_MP55090-01_MP55094-02_WB_01.jpg?t=1718074106|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2357_G195(Me)_DB_01.jpg?t=1718074106|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2357_N14968-5(Me)_IHC_01.jpg?t=1718074106|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2357_N14968-5(Me)_IHC_02.jpg?t=1718074106|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2357_N20427-5(Me)_ChIP_01.jpg?t=1718074106 [Review] => 8 [Publication] => 66 [MoleculeName] => H3K4me3 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

TriMethyl-Histone H3-K4 Rabbit pAb

Catalog:A2357

GeneID:82908350

Application:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC (intra)ELISA(ELISA)MeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Synonyms:H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K4

Type:Rabbit Polyclonal Antibody

Array ( [_title] => TriMethyl-Histone H3-K36 Rabbit mAb [_Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K36 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K36, TriMethylHistone H3-K36, TriMethyl Histone H3-K36, H3K36me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K36,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K36, TriMethylHistone H3-K36, TriMethyl Histone H3-K36, H3K36me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/ [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 24564 [catid] => 413 [title] => TriMethyl-Histone H3-K36 Rabbit mAb [url] => /catalog/A20379 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A20379 [Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K36 [description] => TriMethyl-Histone H3-K36 Rabbit mAb [applications] => ELISA,DB,WB,IP,IHC-P,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => [field_s4] => A synthetic trimethylated peptide around K36 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
IHC-P,1:100 - 1:500
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:50 - 1:100 [field_s8] => [field_s9] => TriMethyl K36 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K36, TriMethylHistone H3-K36, TriMethyl Histone H3-K36, H3K36me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K36,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K36, TriMethylHistone H3-K36, TriMethyl Histone H3-K36, H3K36me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/ [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20379_ARC50050-01_ChIP-seq_01.jpg?t=1713322921|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20379_ARC50050-01_WB_01.jpg?t=1713322921|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20379_ARC50050-01_DotBlot_01.jpg?t=1713322921|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20379_ARC50050-01_IHC_02.jpg?t=1713322921|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20379_ARC50050-01_IHC_01.jpg?t=1713322921|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20379_ARC50050-01_IP_01.jpg?t=1713322921|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20379_ARC50050-01_ChIP_01.jpg?t=1713322921 [Review] => 0 [Publication] => 3 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )
重组兔单抗

TriMethyl-Histone H3-K36 Rabbit mAb

Catalog:A20379

GeneID:82908350

Application:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC (intra)ELISA(ELISA)MeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Synonyms:H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K36

Type:Rabbit Monoclonal Antibody

Array ( [_title] => TriMethyl-Histone H3-K4 Rabbit mAb [_Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 33518 [catid] => 413 [title] => TriMethyl-Histone H3-K4 Rabbit mAb [url] => /catalog/A22146 [price] => 50 μL,1600,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22146 [Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [description] => TriMethyl-Histone H3-K4 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,CUT&Tag,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic trimethylated peptide around K4 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:10000 - 1:60000
WB,1:10000- 1:60000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
CUT&Tag, 10⁵ cells /1 μg
ChIP-seq,1:50 - 1:200 [field_s8] => [field_s9] => TriMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_ChIP-seq_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_ChIP-seq_02.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_WB_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_DotBlot_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IHC_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IHC_02.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IHC_03.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IF_03.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IF_02.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-03_IF_01.jpg?t=1715045739|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22146_ARC55095-01_ChIP_01.jpg?t=1715045739 [Review] => 0 [Publication] => 2 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )
重组兔单抗

TriMethyl-Histone H3-K4 Rabbit mAb

Catalog:A22146

GeneID:82908350

Application:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC (intra)ELISA(ELISA)MeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Synonyms:H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4

Type:Rabbit Monoclonal Antibody

Array ( [_title] => TriMethyl-Histone H3-K9 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K9 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8309 [catid] => 413 [title] => TriMethyl-Histone H3-K9 Rabbit pAb [url] => /catalog/A2360 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2360 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K9 [description] => TriMethyl-Histone H3-K9 Rabbit pAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic trimethylated peptide around K9 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:2000
WB,1:100 - 1:500
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,2.5μg antibody for 5μg-10μg of Chromatin [field_s8] => yes [field_s9] => TriMethyl K9 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K9, TriMethylHistone H3-K9, TriMethyl Histone H3-K9, H3K9me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [field_l3] => ARKST [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N10094-5(Me)_WB_01.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_E269(Me)_DB_01.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N576(H)(Me)(AX)_IHC_01.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N576(H)(Me)(AX)_IHC_02.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15432-5(Me)_IF_01.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15432-5(Me)_IF_02.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15432-5(Me)_IF_03.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15432-5(Me)_IF_04.jpg?t=1715048268|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2360_N15832-5(Me)_ChIP_01.jpg?t=1715048268 [Review] => 6 [Publication] => 49 [MoleculeName] => H3K9me3 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

TriMethyl-Histone H3-K9 Rabbit pAb

Catalog:A2360

GeneID:82908350

Application:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC (intra)ELISA(ELISA)MeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Synonyms:H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K9

Type:Rabbit Polyclonal Antibody

Array ( [_title] => DiMethyl-Histone H3-K4 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K4 [_keywords] => [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 4500 [catid] => 413 [title] => DiMethyl-Histone H3-K4 Rabbit mAb [url] => /catalog/A22143 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22143 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K4 [description] => DiMethyl-Histone H3-K4 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,IP,ChIP,ChIP-seq,CUT&Tag [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic dimethylated peptide around K4 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:2000 - 1:6000
WB,1:1000 - 1:5000
IHC-P,1:1000 - 1:5000
IF/ICC,1:50 - 1:200
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:50 - 1:200
CUT&Tag,10⁵ cells /1 μg [field_s8] => [field_s9] => DiMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_ChIP-seq_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_cut-tag_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_WB_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_DotBlot_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_02.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_03.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_04.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IHC_05.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IF_02.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_IP_01.jpg?t=1713324352|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22143_ARC55489-01_ChIP_01.jpg?t=1713324352 [Review] => 0 [Publication] => 1 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )
重组兔单抗

DiMethyl-Histone H3-K4 Rabbit mAb

Catalog:A22143

GeneID:82908350

Application:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC (intra)ELISA(ELISA)MeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Synonyms:H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K4

Type:Rabbit Monoclonal Antibody

Array ( [_title] => TriMethyl-Histone H3-K4 Rabbit mAb [_Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 33674 [catid] => 413 [title] => TriMethyl-Histone H3-K4 Rabbit mAb [url] => /catalog/A22225 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22225 [Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4 [description] => TriMethyl-Histone H3-K4 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic trimethylated peptide around K4 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:10000 - 1:60000
WB,1:10000 - 1:30000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => TriMethyl K4 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K4, TriMethylHistone H3-K4, TriMethyl Histone H3-K4, H3K4me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/ [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_WB_01.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_DotBlot_01.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_IHC_01.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_IHC_02.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_IHC_03.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_IF_01.jpg?t=1715045863|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22225_ARC55092-01_ChIP_01.jpg?t=1715045863 [Review] => 0 [Publication] => 1 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )
重组兔单抗

TriMethyl-Histone H3-K4 Rabbit mAb

Catalog:A22225

GeneID:82908350

Application:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC (intra)ELISA(ELISA)MeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Synonyms:H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; TriMethyl-Histone H3-K4

Type:Rabbit Monoclonal Antibody

Array ( [_title] => Asymmetric DiMethyl-Histone H3-R8 Rabbit mAb [_Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; Asymmetric DiMethyl-Histone H3-R8 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Asymmetric DiMethyl-Histone H3-R8, Asymmetric DiMethylHistone H3-R8, Asymmetric DiMethyl Histone H3-R8, H3R8me2a, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3R8, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Asymmetric DiMethyl-Histone H3-R8, Asymmetric DiMethylHistone H3-R8, Asymmetric DiMethyl Histone H3-R8, H3R8me2a, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histo [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 33508 [catid] => 413 [title] => Asymmetric DiMethyl-Histone H3-R8 Rabbit mAb [url] => /catalog/A22144 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22144 [Synonyms] => H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; Asymmetric DiMethyl-Histone H3-R8 [description] => Asymmetric DiMethyl-Histone H3-R8 Rabbit mAb [applications] => ELISA,WB,IHC-P,DB [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic asymmetric dimethylated peptide around R8 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:2000 - 1:4000
IHC-P,1:50 - 1:200
DB,1:5000 - 1:8000 [field_s8] => [field_s9] => Asymmetric DiMethyl R8 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Asymmetric DiMethyl-Histone H3-R8, Asymmetric DiMethylHistone H3-R8, Asymmetric DiMethyl Histone H3-R8, H3R8me2a, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3R8, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Asymmetric DiMethyl-Histone H3-R8, Asymmetric DiMethylHistone H3-R8, Asymmetric DiMethyl Histone H3-R8, H3R8me2a, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histo [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22144_ARC54909-01_WB_01.jpg?t=1715045719|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22144_ARC54909-01_DotBlot_02.jpg?t=1715045719|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22144_ARC54909-01_IHC_01.jpg?t=1715045719|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22144_ARC54909-01_IHC_02.jpg?t=1715045719|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22144_ARC54909-01_IHC_03.jpg?t=1715045719|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22144_ARC54909-01_IHC_04.jpg?t=1715045719 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 114 [datasheet] => [validation] => 0 [status_cn] => 1 )
重组兔单抗

Asymmetric DiMethyl-Histone H3-R8 Rabbit mAb

Catalog:A22144

GeneID:82908350

Application:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC (intra)ELISA(ELISA)MeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Synonyms:H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A; Asymmetric DiMethyl-Histone H3-R8

Type:Rabbit Monoclonal Antibody

Array ( [_title] => DiMethyl-Histone H3-K36 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K36 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker, DiMethyl-Histone H3-K36,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histon [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 33464 [catid] => 413 [title] => DiMethyl-Histone H3-K36 Rabbit mAb [url] => /catalog/A22087 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22087 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K36 [description] => DiMethyl-Histone H3-K36 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,IP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic dimethylated peptide around K36 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:2000 - 1:10000
WB,1:2000 - 1:10000
IHC-P,1:1000 - 1:5000
IF/ICC,1:50 - 1:200
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells [field_s8] => [field_s9] => DiMethyl K36 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker, DiMethyl-Histone H3-K36,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histon [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_WB_01.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_DotBlot_01.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_01.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_02.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_03.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_04.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_05.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_06.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_07.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IHC_08.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IF_01.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IF_02.jpg?t=1713323345|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22087_ARC54175-01_IP_01.jpg?t=1713323345 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )
重组兔单抗

DiMethyl-Histone H3-K36 Rabbit mAb

Catalog:A22087

GeneID:82908350

Application:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC (intra)ELISA(ELISA)MeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Synonyms:H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K36

Type:Rabbit Monoclonal Antibody

Array ( [_title] => DiMethyl-Histone H3-K36 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K36 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker, DiMethyl-Histone H3-K36,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histon [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 33663 [catid] => 413 [title] => DiMethyl-Histone H3-K36 Rabbit mAb [url] => /catalog/A22221 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22221 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K36 [description] => DiMethyl-Histone H3-K36 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic dimethylated peptide around K36 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:1000 - 1:5000
WB,1:1000 - 1:5000
IHC-P,1:50 -1:200 [field_s8] => [field_s9] => DiMethyl K36 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker, DiMethyl-Histone H3-K36,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histon [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22221_ARC54173-01_WB_01.jpg?t=1715045843|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22221_ARC54173-01_DotBlot_01.jpg?t=1715045843|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22221_ARC54173-01_IHC_01.jpg?t=1715045843|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22221_ARC54173-01_IHC_02.jpg?t=1715045843 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )
重组兔单抗

DiMethyl-Histone H3-K36 Rabbit mAb

Catalog:A22221

GeneID:82908350

Application:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC (intra)ELISA(ELISA)MeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Synonyms:H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K36

Type:Rabbit Monoclonal Antibody

Array ( [_title] => DiMethyl-Histone H3-K79 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K79 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker, DiMethyl-Histone H3-K79,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histon [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 33463 [catid] => 413 [title] => DiMethyl-Histone H3-K79 Rabbit mAb [url] => /catalog/A22086 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22086 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K79 [description] => DiMethyl-Histone H3-K79 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,IP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic dimethylated peptide around K79 of human Histone H3-K79 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:2000 - 1:20000
WB,1:2000 - 1:20000
IHC-P,1:500 - 1:1000
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
ChIP-seq,1:50 - 1:200 [field_s8] => [field_s9] => DiMethyl K79 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K4, marker, Chromatin, Chromatin marker, DiMethyl-Histone H3-K79,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, DiMethyl-Histone H3-K4, DiMethylHistone H3-K4, DiMethyl Histone H3-K4, H3K4me2, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histon [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_ChIP-seq_01.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_WB_01.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_DotBlot_01.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IHC_05.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IHC_03.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IHC_01.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IHC_02.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IHC_04.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IHC_06.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IF_03.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IF_04.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_IP_01.jpg?t=1713323323|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22086_ARC54084-01_ChIP_01.jpg?t=1713323323 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )
重组兔单抗

DiMethyl-Histone H3-K79 Rabbit mAb

Catalog:A22086

GeneID:82908350

Application:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC (intra)ELISA(ELISA)MeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Synonyms:H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; DiMethyl-Histone H3-K79

Type:Rabbit Monoclonal Antibody

Array ( [_title] => DiMethyl-Histone H4-K20 Rabbit mAb [_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; DiMethyl-Histone H4-K20 [_keywords] => [_Symbol] => Histone H4 [_GeneID] => 8359 [id] => 33920 [catid] => 413 [title] => DiMethyl-Histone H4-K20 Rabbit mAb [url] => /catalog/A22269 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22269 [Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; DiMethyl-Histone H4-K20 [description] => DiMethyl-Histone H4-K20 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => 11kDa [field_s4] => A synthetic dimethylated peptide around K20 of human Histone H4 (NP_003539.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IHC-P,1:1000 - 1:5000 [field_s8] => [field_s9] => DiMethyl K20 [field_s10] => Unconjugated [field_s12] => [keywords] => [field_l3] => MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22269_ARC55059-01_WB_01.jpg?t=1713323573|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22269_ARC55059-01_DotBlot_01.jpg?t=1713323573|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22269_ARC55059-01_IHC_06.jpg?t=1713323573|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22269_ARC55059-01_IHC_03.jpg?t=1713323573|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22269_ARC55059-01_IHC_02.jpg?t=1713323573|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22269_ARC55059-01_IHC_04.jpg?t=1713323573|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22269_ARC55059-01_IHC_05.jpg?t=1713323573|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22269_ARC55059-01_IHC_01.jpg?t=1713323573 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H4 [posid] => 0 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )
重组兔单抗

DiMethyl-Histone H4-K20 Rabbit mAb

Catalog:A22269

GeneID:8359

Application:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC (intra)ELISA(ELISA)MeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Synonyms:H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; DiMethyl-Histone H4-K20

Type:Rabbit Monoclonal Antibody

Array ( [_title] => DiMethyl-Histone H4-K20 Rabbit mAb [_Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; DiMethyl-Histone H4-K20 [_keywords] => H4, H4/n, H4C1, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2, H4FN, FO108, H4-16, H4C11, H4C12, H4C13, H4C15, HIST2H4, HIST2H4A, DiMethyl-Histone H4-K20,KO/KDantibodyH4, H4/n, H4C1, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2, H4FN, FO108, H4-16, H4C11, H4C12, H4C13, H4C15, HIST2H4, HIST2H4A, DiMethyl-Histone H4-K20,PTMantibodyH4, H4/n, H4C1, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2, H4FN, FO108, H4-16, H4C11, H4C12, H4C13, H4C15, HIST2H4, HIST2H4A, DiMethyl-Histone H4-K20,小分子antibody [_Symbol] => Histone H4 [_GeneID] => 8359 [id] => 33921 [catid] => 413 [title] => DiMethyl-Histone H4-K20 Rabbit mAb [url] => /catalog/A22268 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22268 [Synonyms] => H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; DiMethyl-Histone H4-K20 [description] => DiMethyl-Histone H4-K20 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 11kDa [field_s3] => 11kDa [field_s4] => A synthetic dimethylated peptide around K20 of human Histone H4 (NP_003539.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IHC-P,1:500 - 1:1000
IF/ICC,1:500 - 1:1000 [field_s8] => [field_s9] => DiMethyl K20 [field_s10] => Unconjugated [field_s12] => [keywords] => H4, H4/n, H4C1, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2, H4FN, FO108, H4-16, H4C11, H4C12, H4C13, H4C15, HIST2H4, HIST2H4A, DiMethyl-Histone H4-K20,KO/KD抗体H4, H4/n, H4C1, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2, H4FN, FO108, H4-16, H4C11, H4C12, H4C13, H4C15, HIST2H4, HIST2H4A, DiMethyl-Histone H4-K20,PTM抗体H4, H4/n, H4C1, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2, H4FN, FO108, H4-16, H4C11, H4C12, H4C13, H4C15, HIST2H4, HIST2H4A, DiMethyl-Histone H4-K20,小分子抗体 [field_l3] => MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22268_ARC55058-01_WB_01.jpg?t=1715045945|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22268_ARC55058-01_DotBlot_01.jpg?t=1715045945|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22268_ARC55058-01_IHC_01.jpg?t=1715045945|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22268_ARC55058-01_IHC_02.jpg?t=1715045945|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22268_ARC55058-01_IHC_03.jpg?t=1715045945|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22268_ARC55058-01_IF_01.jpg?t=1715045945 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H4 [posid] => 0 [GeneID] => Array ( [0] => 8359 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )
重组兔单抗

DiMethyl-Histone H4-K20 Rabbit mAb

Catalog:A22268

GeneID:8359

Application:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC (intra)ELISA(ELISA)MeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Synonyms:H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A; DiMethyl-Histone H4-K20

Type:Rabbit Monoclonal Antibody

Array ( [_title] => MonoMethyl-Histone H3-K18 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K18 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker, MonoMethyl-Histone H3-K18,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histon [_Symbol] => Histone H3 [_GeneID] => 8290/8350 [id] => 30847 [catid] => 413 [title] => MonoMethyl-Histone H3-K18 Rabbit mAb [url] => /catalog/A20680 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A20680 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K18 [description] => MonoMethyl-Histone H3-K18 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IP,IF/ICC,ChIP,CUT&Tag [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic monomethylated peptide around K18 of human histone H3 (P68431). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
CUT&Tag, 10⁵ cells /1 μg [field_s8] => [field_s9] => MonoMethyl K9 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K9, marker, Chromatin, Chromatin marker, MonoMethyl-Histone H3-K18,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, MonoMethyl-Histone H3-K9, MonoMethylHistone H3-K9, MonoMethyl Histone H3-K9, H3K9me1, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histon [field_l3] => APRKQ [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_ChIP-seq_01.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_WB_01.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_DotBlot_01.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_IHC_01.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_IHC_02.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_IHC_03.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_IF_01.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_IF_02.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_IP_01.jpg?t=1714989343|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A20680_ARC2621_ChIP_01.jpg?t=1714989343 [Review] => 0 [Publication] => 0 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => Histone H3 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )
重组兔单抗

MonoMethyl-Histone H3-K18 Rabbit mAb

Catalog:A20680

GeneID:82908350

Application:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC (intra)ELISA(ELISA)MeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition

Reactivity:Human, Mouse, Rat, Other (Wide Range Predicted)

Synonyms:H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; MonoMethyl-Histone H3-K18

Type:Rabbit Monoclonal Antibody