我们为您找到 His 的 128 个相关产品结果。 您可以根据左侧筛选功能来找到您需要的产品。

Array ( [_title] => DDX20 Rabbit pAb [_Synonyms] => DP103; GEMIN3; DDX20 [_keywords] => 11218, sc-21430, sc-50405, DDX20, DP103, GEMIN3, DEAD-box helicase 20, probable ATP-dependent RNA helicase DDX20, DEAD (Asp-Glu-Ala-Asp) box polypeptide 20, DEAD box protein 20, DEAD box protein DP 103, DEAD-box protein DP103, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 20, 103kD, SMN-interacting protein, component of gems 3, gemin-3, Q9UHI6, DEAD-Box Helicase 20, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 20, DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 20, DEAD Box Protein DP 103, Component Of Gems 3, DEAD Box Protein 20, Gemin-3, Probable ATP-Dependent RNA Helicase DDX20, SMN-Interacting Protein, DEAD-Box Protein DP103, EC 3.6.4.13, sc21430, sc 21430, sc50405, sc 50405, Component of gems 3, DKFZp434H052, Gemin 3,KO/KDantibody11218, sc-21430, sc-50405, DDX20, DP103, GEMIN3, DEAD-box helicase 20, probable ATP-dependent RNA helicase DDX20, DEAD (Asp-Glu-Ala-Asp) box polypeptide 20, DEAD box protein 20, DEAD box protein DP 103, DEAD-box protein DP103, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 20, 103kD, SMN-inte [_Symbol] => DDX20 [_GeneID] => 11218 [id] => 5785 [catid] => 131 [title] => DDX20 Rabbit pAb [url] => /catalog/A5817 [price] => 50 μL,900,In Stock|100 μL,1500,In Stock|200 μL,2450,In Stock [CatalogNo] => A5817 [Synonyms] => DP103; GEMIN3; DDX20 [description] => DDX20 Rabbit pAb [applications] => ELISA,WB,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => 92kDa [field_s3] => 110kDa [field_s4] => Recombinant fusion protein containing a sequence corresponding to amino acids 25-280 of human DDX20 (NP_009135.4). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:2000
IF/ICC,1:10 - 1:100 [field_s8] => yes [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => 11218, sc-21430, sc-50405, DDX20, DP103, GEMIN3, DEAD-box helicase 20, probable ATP-dependent RNA helicase DDX20, DEAD (Asp-Glu-Ala-Asp) box polypeptide 20, DEAD box protein 20, DEAD box protein DP 103, DEAD-box protein DP103, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 20, 103kD, SMN-interacting protein, component of gems 3, gemin-3, Q9UHI6, DEAD-Box Helicase 20, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 20, DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 20, DEAD Box Protein DP 103, Component Of Gems 3, DEAD Box Protein 20, Gemin-3, Probable ATP-Dependent RNA Helicase DDX20, SMN-Interacting Protein, DEAD-Box Protein DP103, EC 3.6.4.13, sc21430, sc 21430, sc50405, sc 50405, Component of gems 3, DKFZp434H052, Gemin 3,KO/KD抗体11218, sc-21430, sc-50405, DDX20, DP103, GEMIN3, DEAD-box helicase 20, probable ATP-dependent RNA helicase DDX20, DEAD (Asp-Glu-Ala-Asp) box polypeptide 20, DEAD box protein 20, DEAD box protein DP 103, DEAD-box protein DP103, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 20, 103kD, SMN-inte [field_l3] => VQVPAPEPTPGPVRILRTAQDLSSPRTRTGDVLLAEPADFESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPLSQDKTRLKKCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMRDPTFVRLNSSDPSLIGLKQYY [pics] => https://img.abclonal.com.cn/abclonal/Catalog/A5817/A5817_1.jpg?t=1690980642|https://img.abclonal.com.cn/abclonal/Catalog/A5817/A5817_2.jpg?t=1690980681 [Review] => 0 [Publication] => 0 [MoleculeName] => DDX20 [recommend] => 0 [status] => 1 [Symbol] => DDX20 [posid] => 0 [GeneID] => Array ( [0] => 11218 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DDX24 Rabbit pAb [_Synonyms] => DDX24 [_keywords] => 57062, DDX24, DEAD-box helicase 24, ATP-dependent RNA helicase DDX24, DEAD (Asp-Glu-Ala-Asp) box helicase 24, DEAD (Asp-Glu-Ala-Asp) box polypeptide 24, DEAD box protein 24, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 24, S. cerevisiae CHL1-like helicase, Q9GZR7, Ddx24, DEAD-Box Helicase 24, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 24, DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 24, DEAD (Asp-Glu-Ala-Asp) Box Helicase 24, DEAD Box Protein 24, ATP-Dependent RNA Helicase DDX24, S. Cerevisiae CHL1-Like Helicase, EC 3.6.4.13,KO/KDantibody57062, DDX24, DEAD-box helicase 24, ATP-dependent RNA helicase DDX24, DEAD (Asp-Glu-Ala-Asp) box helicase 24, DEAD (Asp-Glu-Ala-Asp) box polypeptide 24, DEAD box protein 24, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 24, S. cerevisiae CHL1-like helicase, Q9GZR7, Ddx24, DEAD-Box Helicase 24, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 24, DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 24, DEAD (Asp-Glu-Ala-Asp) Box Helicase 24, DEAD Box Protein 24, ATP-Dependent RNA Helicase DDX24, S. Ce [_Symbol] => DDX24 [_GeneID] => 57062 [id] => 10335 [catid] => 131 [title] => DDX24 Rabbit pAb [url] => /catalog/A15481 [price] => 50 μL,900,In Stock|100 μL,1500,In Stock|200 μL,2450,In Stock [CatalogNo] => A15481 [Synonyms] => DDX24 [description] => DDX24 Rabbit pAb [applications] => ELISA,WB,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => 96kDa [field_s3] => 120kDa [field_s4] => Recombinant fusion protein containing a sequence corresponding to amino acids 510-859 of human DDX24 (NP_065147.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:200 - 1:2000
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => 57062, DDX24, DEAD-box helicase 24, ATP-dependent RNA helicase DDX24, DEAD (Asp-Glu-Ala-Asp) box helicase 24, DEAD (Asp-Glu-Ala-Asp) box polypeptide 24, DEAD box protein 24, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 24, S. cerevisiae CHL1-like helicase, Q9GZR7, Ddx24, DEAD-Box Helicase 24, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 24, DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 24, DEAD (Asp-Glu-Ala-Asp) Box Helicase 24, DEAD Box Protein 24, ATP-Dependent RNA Helicase DDX24, S. Cerevisiae CHL1-Like Helicase, EC 3.6.4.13,KO/KD抗体57062, DDX24, DEAD-box helicase 24, ATP-dependent RNA helicase DDX24, DEAD (Asp-Glu-Ala-Asp) box helicase 24, DEAD (Asp-Glu-Ala-Asp) box polypeptide 24, DEAD box protein 24, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 24, S. cerevisiae CHL1-like helicase, Q9GZR7, Ddx24, DEAD-Box Helicase 24, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 24, DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 24, DEAD (Asp-Glu-Ala-Asp) Box Helicase 24, DEAD Box Protein 24, ATP-Dependent RNA Helicase DDX24, S. Ce [field_l3] => LTLVHQAPARILHKKHTKKMDKTAKLDLLMQKIGMRGKPKVIDLTRNEATVETLTETKIHCETDEKDFYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDIMPLTLHACMHQKQRLRNLEQFARLEDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATNEGLSLMLIGPEDVINFKKIYKTLKKDEDIPLFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKADQQEERRRQKQMKVLKKELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKKTKKPKEPQPEQPQPSTSAN [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A15481_P14590_WB_01.jpg?t=1709173769|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A15481_P14590_IF_01.jpg?t=1709173769|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A15481_P14590_IF_02.jpg?t=1709173769|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A15481_P14590_IF_03.jpg?t=1709173769 [Review] => 0 [Publication] => 0 [MoleculeName] => DDX24 [recommend] => 0 [status] => 1 [Symbol] => DDX24 [posid] => 0 [GeneID] => Array ( [0] => 57062 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DDX39A Rabbit pAb [_Synonyms] => BAT1; DDXL; BAT1L; DDX39; URH49; DDX39A [_keywords] => 10212, sc-68965, BAT1, BAT1L, DDX39, DDX39A, DDXL, DEAD box protein 39, Nuclear RNA helicase URH49, URH49, DExD-box helicase 39A, ATP-dependent RNA helicase DDX39A, DEAD (Asp-Glu-Ala-Asp) box polypeptide 39, DEAD (Asp-Glu-Ala-Asp) box polypeptide 39A, DEAD-box helicase 39A, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 39, UAP56-related helicase, 49 kDa, nuclear RNA helicase URH49, nuclear RNA helicase, DECD variant of DEAD box family, O00148, Ddx39, DExD-Box Helicase 39A, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 39, UAP56-Related Helicase, 49 KDa, Nuclear RNA Helicase URH49, DEAD-Box Helicase 39A, DEAD Box Protein 39, Nuclear RNA Helicase, DECD Variant Of DEAD Box Family, DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39A, DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39, ATP-Dependent RNA Helicase DDX39A, EC 3.6.4.13, sc68965, sc 68965,KO/KDantibody10212, sc-68965, BAT1, BAT1L, DDX39, DDX39A, DDXL, DEAD box protein 39, Nuclear RNA helicase URH49, URH49, DExD-box helicase 39A, ATP-dependent RNA helicase DDX39A, DEAD (Asp- [_Symbol] => DDX39A [_GeneID] => 10212 [id] => 3764 [catid] => 131 [title] => DDX39A Rabbit pAb [url] => /catalog/A7955 [price] => 50 μL,1150,In Stock|100 μL,1870,In Stock|200 μL,2900,In Stock [CatalogNo] => A7955 [Synonyms] => BAT1; DDXL; BAT1L; DDX39; URH49; DDX39A [description] => DDX39A Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => 49kDa [field_s3] => 49kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDX39A (NP_005795.2). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => 10212, sc-68965, BAT1, BAT1L, DDX39, DDX39A, DDXL, DEAD box protein 39, Nuclear RNA helicase URH49, URH49, DExD-box helicase 39A, ATP-dependent RNA helicase DDX39A, DEAD (Asp-Glu-Ala-Asp) box polypeptide 39, DEAD (Asp-Glu-Ala-Asp) box polypeptide 39A, DEAD-box helicase 39A, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 39, UAP56-related helicase, 49 kDa, nuclear RNA helicase URH49, nuclear RNA helicase, DECD variant of DEAD box family, O00148, Ddx39, DExD-Box Helicase 39A, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 39, UAP56-Related Helicase, 49 KDa, Nuclear RNA Helicase URH49, DEAD-Box Helicase 39A, DEAD Box Protein 39, Nuclear RNA Helicase, DECD Variant Of DEAD Box Family, DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39A, DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39, ATP-Dependent RNA Helicase DDX39A, EC 3.6.4.13, sc68965, sc 68965,KO/KD抗体10212, sc-68965, BAT1, BAT1L, DDX39, DDX39A, DDXL, DEAD box protein 39, Nuclear RNA helicase URH49, URH49, DExD-box helicase 39A, ATP-dependent RNA helicase DDX39A, DEAD (Asp- [field_l3] => MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVL [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7955_Q11102-1_WB_01.jpg?t=1715129920|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7955_P5030_IHC_01.jpg?t=1715129920|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7955_P5030_IHC_02.jpg?t=1715129920|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7955_P5030_IHC_03.jpg?t=1715129920|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7955_Q11102-1_IF_01.jpg?t=1715129920|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7955_Q11102-1_IF_02.jpg?t=1715129920|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7955_Q11102-1_IF_03.jpg?t=1715129920|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7955_Q11105-1_IF_01.jpg?t=1715129920|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7955_Q11105-1_IF_02.jpg?t=1715129920|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7955_Q11105-1_IF_03.jpg?t=1715129920 [Review] => 0 [Publication] => 0 [MoleculeName] => DDX39A [recommend] => 0 [status] => 1 [Symbol] => DDX39A [posid] => 0 [GeneID] => Array ( [0] => 10212 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => DDX3Y Rabbit pAb [_Synonyms] => DBY; DDX3Y [_keywords] => 8653, DBY, DDX3Y, DEAD-box helicase 3, Y-linked, ATP-dependent RNA helicase DDX3Y, DEAD (Asp-Glu-Ala-Asp) box helicase 3, DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, DEAD box protein 3, Y-chromosomal, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, Y chromosome, O15523, DEAD-Box Helicase 3 Y-Linked, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide, Y Chromosome, DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, Y-Linked, DEAD (Asp-Glu-Ala-Asp) Box Helicase 3, DEAD Box Protein 3, Y-Chromosomal, ATP-Dependent RNA Helicase DDX3Y, DEAD-Box Helicase 3, EC 3.6.4.13,KO/KDantibody8653, DBY, DDX3Y, DEAD-box helicase 3, Y-linked, ATP-dependent RNA helicase DDX3Y, DEAD (Asp-Glu-Ala-Asp) box helicase 3, DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, DEAD box protein 3, Y-chromosomal, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, Y chromosome, O15523, DEAD-Box Helicase 3 Y-Linked, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide, Y Chromosome, DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, Y-Linked, DEAD (Asp-Glu-Ala-Asp) Box Helicase 3, DEAD Box Protei [_Symbol] => DDX3Y [_GeneID] => 8653 [id] => 14416 [catid] => 131 [title] => DDX3Y Rabbit pAb [url] => /catalog/A11704 [price] => 50 μL,900,In Stock|100 μL,1500,In Stock|200 μL,2450,In Stock [CatalogNo] => A11704 [Synonyms] => DBY; DDX3Y [description] => DDX3Y Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => 73kDa [field_s3] => 73kDa [field_s4] => Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human DDX3Y (NP_001116137.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:2000
IHC-P,1:50 - 1:100
IF/ICC,1:50 - 1:100 [field_s8] => yes [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => 8653, DBY, DDX3Y, DEAD-box helicase 3, Y-linked, ATP-dependent RNA helicase DDX3Y, DEAD (Asp-Glu-Ala-Asp) box helicase 3, DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, DEAD box protein 3, Y-chromosomal, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, Y chromosome, O15523, DEAD-Box Helicase 3 Y-Linked, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide, Y Chromosome, DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, Y-Linked, DEAD (Asp-Glu-Ala-Asp) Box Helicase 3, DEAD Box Protein 3, Y-Chromosomal, ATP-Dependent RNA Helicase DDX3Y, DEAD-Box Helicase 3, EC 3.6.4.13,KO/KD抗体8653, DBY, DDX3Y, DEAD-box helicase 3, Y-linked, ATP-dependent RNA helicase DDX3Y, DEAD (Asp-Glu-Ala-Asp) box helicase 3, DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, DEAD box protein 3, Y-chromosomal, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, Y chromosome, O15523, DEAD-Box Helicase 3 Y-Linked, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide, Y Chromosome, DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 3, Y-Linked, DEAD (Asp-Glu-Ala-Asp) Box Helicase 3, DEAD Box Protei [field_l3] => MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDAYSSFGSRDSRGKPGYFSERGSGSRGRFDDRGRSDYDGIGNRERPGFGRFERSGHSRWCDKSVEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGSNCPPHIENFSDIDMGEIIMGNIELTRYTRPTPVQKHAIP [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11704_P10452_WB_01.jpg?t=1718073481|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11704_P10452_IHC_01.jpg?t=1718073481|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11704_P10452_IHC_02.jpg?t=1718073481|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11704_P10452_IHC_03.jpg?t=1718073481|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11704_P10452_IHC_04.jpg?t=1718073481|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11704_P10452_IF_01.jpg?t=1718073481|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11704_P10452_IF_02.jpg?t=1718073481|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A11704_P10452_IF_03.jpg?t=1718073481 [Review] => 0 [Publication] => 0 [MoleculeName] => DDX3Y [recommend] => 0 [status] => 1 [Symbol] => DDX3Y [posid] => 0 [GeneID] => Array ( [0] => 8653 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => LIMS1 Rabbit pAb [_Synonyms] => PINCH; PINCH1; PINCH-1; LIMS1 [_keywords] => 3987, sc-47912, sc-47915, sc-47914, sc-67177, LIMS1, PINCH, PINCH-1, PINCH1, LIM zinc finger domain containing 1, LIM and senescent cell antigen-like-containing domain protein 1, LIM and senescent cell antigen-like domains 1, LIM-type zinc finger domains 1, particularly interesting new Cys-His protein 1, renal carcinoma antigen NY-REN-48, senescent cell antigen, P48059, LIM Zinc Finger Domain Containing 1, Particularly Interesting New Cys-His Protein 1, LIM And Senescent Cell Antigen-Like Domains 1, Renal Carcinoma Antigen NY-REN-48, LIM-Type Zinc Finger Domains 1, Senescent Cell Antigen, LIM And Senescent Cell Antigen-Like-Containing Domain Protein 1, PINCH 1, sc47912, sc 47912, sc47915, sc 47915, sc47914, sc 47914, sc67177, sc 67177,KO/KDantibody3987, sc-47912, sc-47915, sc-47914, sc-67177, LIMS1, PINCH, PINCH-1, PINCH1, LIM zinc finger domain containing 1, LIM and senescent cell antigen-like-containing domain protein 1, LIM and senescent cell antigen-like domains 1, LIM-type zinc finger domains 1, particular [_Symbol] => LIMS1 [_GeneID] => 3987 [id] => 5326 [catid] => 131 [title] => LIMS1 Rabbit pAb [url] => /catalog/A6384 [price] => 50 μL,900,In Stock|100 μL,1500,In Stock|200 μL,2450,In Stock [CatalogNo] => A6384 [Synonyms] => PINCH; PINCH1; PINCH-1; LIMS1 [description] => LIMS1 Rabbit pAb [applications] => ELISA,WB,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => 37kDa [field_s3] => 40kDa [field_s4] => Recombinant fusion protein containing a sequence corresponding to amino acids 1-325 of human LIMS1 (NP_001180417.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:2000
IF/ICC,1:50 - 1:100 [field_s8] => yes [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => 3987, sc-47912, sc-47915, sc-47914, sc-67177, LIMS1, PINCH, PINCH-1, PINCH1, LIM zinc finger domain containing 1, LIM and senescent cell antigen-like-containing domain protein 1, LIM and senescent cell antigen-like domains 1, LIM-type zinc finger domains 1, particularly interesting new Cys-His protein 1, renal carcinoma antigen NY-REN-48, senescent cell antigen, P48059, LIM Zinc Finger Domain Containing 1, Particularly Interesting New Cys-His Protein 1, LIM And Senescent Cell Antigen-Like Domains 1, Renal Carcinoma Antigen NY-REN-48, LIM-Type Zinc Finger Domains 1, Senescent Cell Antigen, LIM And Senescent Cell Antigen-Like-Containing Domain Protein 1, PINCH 1, sc47912, sc 47912, sc47915, sc 47915, sc47914, sc 47914, sc67177, sc 67177,KO/KD抗体3987, sc-47912, sc-47915, sc-47914, sc-67177, LIMS1, PINCH, PINCH-1, PINCH1, LIM zinc finger domain containing 1, LIM and senescent cell antigen-like-containing domain protein 1, LIM and senescent cell antigen-like domains 1, LIM-type zinc finger domains 1, particular [field_l3] => MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKPVCKKCYEKFPLELKKRLKKLAETLGRK [pics] => https://img.abclonal.com.cn/abclonal/Catalog/A6384/A6384_1.jpg?t=1690980132|https://img.abclonal.com.cn/abclonal/Catalog/A6384/A6384_2.jpg?t=1690980134 [Review] => 0 [Publication] => 0 [MoleculeName] => LIMS1 [recommend] => 0 [status] => 1 [Symbol] => LIMS1 [posid] => 0 [GeneID] => Array ( [0] => 3987 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Rig-I/DDX58 Rabbit pAb [_Synonyms] => RIG1; DDX58; RIG-I; RLR-1; SGMRT2; Rig-I/DDX58 [_keywords] => 23586, sc-48929, sc-48932, sc-98911, DDX58, DEAD box protein 58, RIG 1, RIG I, RIG-I, RIGI, RLR-1, SGMRT2, DExD/H-box helicase 58, probable ATP-dependent RNA helicase DDX58, DEAD (Asp-Glu-Ala-Asp) box polypeptide 58, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, RNA helicase RIG-I, retinoic acid-inducible gene 1 protein, retinoic acid-inducible gene I protein, O95786, DExD/H-Box Helicase 58, DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 58, Retinoic Acid-Inducible Gene 1 Protein, Retinoic Acid-Inducible Gene I Protein, DEAD Box Protein 58, RNA Helicase RIG-I, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide, Probable ATP-Dependent RNA Helicase DDX58, Retinoic Acid Inducible Gene I, RIG-I-Like Receptor 1, EC 3.6.4.13, RIG-1, RIG-I/DDX58, DKFZp434J1111, DKFZp686N19181, FLJ13599, 免疫, 炎症, 天然免疫, 感染, 病毒, 自身免疫, Mavs, Rig-I/DDX58,KO/KDantibody23586, sc-48929, sc-48932, sc-98911, DDX58, DEAD box protein 58, RIG 1, RIG I, RIG-I, RIGI, RLR-1, SGMRT2, DExD/H-box helicase 58, probable ATP-dependent RNA [_Symbol] => RIGI [_GeneID] => 23586 [id] => 12507 [catid] => 131 [title] => Rig-I/DDX58 Rabbit pAb [url] => /catalog/A13407 [price] => 50 μL,1150,In Stock|100 μL,1870,In Stock|200 μL,2900,In Stock [CatalogNo] => A13407 [Synonyms] => RIG1; DDX58; RIG-I; RLR-1; SGMRT2; Rig-I/DDX58 [description] => Rig-I/DDX58 Rabbit pAb [applications] => ELISA,WB,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => 107kDa [field_s3] => 102-110kDa [field_s4] => Recombinant fusion protein containing a sequence corresponding to amino acids 726-925 of human Rig-I/DDX58 (NP_055129.2). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:2000
IF/ICC,1:50 - 1:200 [field_s8] => yes [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => 23586, sc-48929, sc-48932, sc-98911, DDX58, DEAD box protein 58, RIG 1, RIG I, RIG-I, RIGI, RLR-1, SGMRT2, DExD/H-box helicase 58, probable ATP-dependent RNA helicase DDX58, DEAD (Asp-Glu-Ala-Asp) box polypeptide 58, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide, RNA helicase RIG-I, retinoic acid-inducible gene 1 protein, retinoic acid-inducible gene I protein, O95786, DExD/H-Box Helicase 58, DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 58, Retinoic Acid-Inducible Gene 1 Protein, Retinoic Acid-Inducible Gene I Protein, DEAD Box Protein 58, RNA Helicase RIG-I, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide, Probable ATP-Dependent RNA Helicase DDX58, Retinoic Acid Inducible Gene I, RIG-I-Like Receptor 1, EC 3.6.4.13, RIG-1, RIG-I/DDX58, DKFZp434J1111, DKFZp686N19181, FLJ13599, 免疫, 炎症, 天然免疫, 感染, 病毒, 自身免疫, Mavs, Rig-I/DDX58,KO/KD抗体23586, sc-48929, sc-48932, sc-98911, DDX58, DEAD box protein 58, RIG 1, RIG I, RIG-I, RIGI, RLR-1, SGMRT2, DExD/H-box helicase 58, probable ATP-dependent RNA [field_l3] => QTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK [pics] => https://img.abclonal.com.cn/abclonal/Catalog/A13407/A13407_1.jpg?t=1690973421|https://img.abclonal.com.cn/abclonal/Catalog/A13407/A13407_2.jpg?t=1690973469|https://img.abclonal.com.cn/abclonal/Catalog/A13407/A13407_3.jpg?t=1690973524|https://img.abclonal.com.cn/abclonal/Catalog/A13407/A13407_4.jpg?t=1690973579 [Review] => 0 [Publication] => 0 [MoleculeName] => DDX58 [recommend] => 0 [status] => 1 [Symbol] => RIGI [posid] => 0 [GeneID] => Array ( [0] => 23586 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Histone H3 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Histone H3 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, marker, Chromatin, Chromatin marker,PTMantibody [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8329 [catid] => 131 [title] => Histone H3 Rabbit pAb [url] => /catalog/A2348 [price] => 50 μL,1150,In Stock|100 μL,1870,In Stock|200 μL,2900,In Stock [CatalogNo] => A2348 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Histone H3 [description] => Histone H3 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC,IP,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 36-136 of human HIST3H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:2000 - 1:10000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
IP,0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
ChIP,3μg antibody for 5μg-10μg of Chromatin [field_s8] => yes [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, marker, Chromatin, Chromatin marker,PTM抗体 [field_l3] => VKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_aG307-12_WB_01.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N342_IHC_01.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N342_IHC_02.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N342_IHC_03.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N342_IHC_04.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_aG307-12_IF_01.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_aG307-12_IF_02.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N13848-6_IP_01.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N13847-6_IP_01.jpg?t=1715047861|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2348_N13847-6_ChIP_01.jpg?t=1715047861 [Review] => 5 [Publication] => 166 [MoleculeName] => HIST3H3 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => TriMethyl-Histone H3-K27 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, H [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 8310 [catid] => 413 [title] => TriMethyl-Histone H3-K27 Rabbit pAb [url] => /catalog/A2363 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A2363 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K27 [description] => TriMethyl-Histone H3-K27 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC,IP,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:500 - 1:1000
WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
IP,0.5ug-4ug antibody for 400ug-600ug extracts of whole cells
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100 [field_s8] => yes [field_s9] => TriMethyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/I, Histone H3/j, Histone H3/k, Histone H3/l, H3K27, anti-H3K27me3, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, TriMethyl-Histone H3-K27, TriMethylHistone H3-K27, TriMethyl Histone H3-K27, H3K27me3, HIST1H3J, H3/j, H3FJ, Histone H3.1, Histone H3/a, Histone H3/b, Histone H3/c, H [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_N15995(Me)_WB_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_E1559(SMe)_DB_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_N20413-5(Me)_IHC_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_N15995-5(Me)_IF_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_aQ5382(Me)(2)_ChIP_01.jpg?t=1715048293|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A2363_N15996-5(Me)_ChIP_01.jpg?t=1715048293 [Review] => 11 [Publication] => 80 [MoleculeName] => H3K27me3 [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 1 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Phospho-Histone H2AX-S139 Rabbit mAb [_Synonyms] => H2A.X; H2A/X; H2AFX; Phospho-Histone H2AX-S139 [_keywords] => 3014, sc-67218, H2A histone family, member X, H2A.X, H2A/X, H2AFX, H2AX, Histone H2A.x, H2A histone family member X, histone H2AX, H2AX histone, histone H2A.x, P16104, H2afx, H2A Histone Family Member X, Histone H2A.X, H2A Histone Family, Member X, H2AX Histone, Histone H2AX, H2a/X, gamma H2A.X, GammaH2AX, gamma H2AX, 磷酸化, H2AXS139, Phospho-Histone H2AX-S139,KO/KDantibody3014, sc-67218, H2A histone family, member X, H2A.X, H2A/X, H2AFX, H2AX, Histone H2A.x, H2A histone family member X, histone H2AX, H2AX histone, histone H2A.x, P16104, H2afx, H2A Histone Family Member X, Histone H2A.X, H2A Histone Family, Member X, H2AX Histone, Histone H2AX, H2a/X, gamma H2A.X, GammaH2AX, gamma H2AX, 磷酸化, H2AXS139, Phospho-Histone H2AX-S139,PTMantibody3014, sc-67218, H2A histone family, member X, H2A.X, H2A/X, H2AFX, H2AX, Histone H2A.x, H2A histone family member X, histone H2AX, H2AX histone, histone H2A.x, P16104, H2afx, H2A Histone Family Member X, Histone H2A.X, H2A Histone Family, Member X, H2AX Histone, Histone H2AX, [_Symbol] => H2AX [_GeneID] => 3014 [id] => 20247 [catid] => 414 [title] => Phospho-Histone H2AX-S139 Rabbit mAb [url] => /catalog/AP0687 [price] => 50 μL,1600,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => AP0687 [Synonyms] => H2A.X; H2A/X; H2AFX; Phospho-Histone H2AX-S139 [description] => Phospho-Histone H2AX-S139 Rabbit mAb [applications] => ELISA,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic phosphorylated peptide around S139 of human Histone H2A.X (P16104). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200 [field_s8] => [field_s9] => Phospho S139 [field_s10] => Unconjugated [field_s12] => [keywords] => 3014, sc-67218, H2A histone family, member X, H2A.X, H2A/X, H2AFX, H2AX, Histone H2A.x, H2A histone family member X, histone H2AX, H2AX histone, histone H2A.x, P16104, H2afx, H2A Histone Family Member X, Histone H2A.X, H2A Histone Family, Member X, H2AX Histone, Histone H2AX, H2a/X, gamma H2A.X, γH2AX, gamma H2AX, 磷酸化, H2AXS139, Phospho-Histone H2AX-S139,KO/KD抗体3014, sc-67218, H2A histone family, member X, H2A.X, H2A/X, H2AFX, H2AX, Histone H2A.x, H2A histone family member X, histone H2AX, H2AX histone, histone H2A.x, P16104, H2afx, H2A Histone Family Member X, Histone H2A.X, H2A Histone Family, Member X, H2AX Histone, Histone H2AX, H2a/X, gamma H2A.X, γH2AX, gamma H2AX, 磷酸化, H2AXS139, Phospho-Histone H2AX-S139,PTM抗体3014, sc-67218, H2A histone family, member X, H2A.X, H2A/X, H2AFX, H2AX, Histone H2A.x, H2A histone family member X, histone H2AX, H2AX histone, histone H2A.x, P16104, H2afx, H2A Histone Family Member X, Histone H2A.X, H2A Histone Family, Member X, H2AX Histone, Histone H2AX, [field_l3] => TQASQ [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0687_ARC0110_WB_01.jpg?t=1717046929|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0687_ARC0110_WB_02.jpg?t=1717046929|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0687_ARC0110_IHC_02.jpg?t=1717046929|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0687_ARC0110_IHC_01.jpg?t=1717046929|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0687_ARC0110_IHC_03.jpg?t=1717046929|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0687_ARC0110-04_IF_01.jpg?t=1717046929 [Review] => 3 [Publication] => 31 [MoleculeName] => H2AX [recommend] => 1 [status] => 1 [Symbol] => H2AX [posid] => 0 [GeneID] => Array ( [0] => 3014 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Acetyl-Histone H3-K9 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K9 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K9, AcetylHistone H3-K9, Acetyl Histone H3-K9, H3K9ac, H3K9, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K9, AcetylHistone H3-K9, Acetyl Histone H3-K9, H3K9ac, H3K9, marker, Chromatin, Chromatin marker,PTMantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 862 [catid] => 722 [title] => Acetyl-Histone H3-K9 Rabbit pAb [url] => /catalog/A7255 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A7255 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K9 [description] => Acetyl-Histone H3-K9 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC,IP,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 16kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
IP,0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:50 [field_s8] => yes [field_s9] => Acetyl K9 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K9, AcetylHistone H3-K9, Acetyl Histone H3-K9, H3K9ac, H3K9, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K9, AcetylHistone H3-K9, Acetyl Histone H3-K9, H3K9ac, H3K9, marker, Chromatin, Chromatin marker,PTM抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_N628(8-9)(A)_WB_01.jpg?t=1716189430|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_N628(8-9)(A)_WB_02.jpg?t=1716189430|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_N628(8-9)(A)_WB_03.jpg?t=1716189430|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_Q5600(H)(A)(AX)_IHC_01.jpg?t=1716189430|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_Q5600(H)(A)(AX)_IHC_02.jpg?t=1716189430|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_Q5600(H)(A)(AX)_IHC_03.jpg?t=1716189430|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_Q5600(H)(A)(AX)_IHC_04.jpg?t=1716189430|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_N633-4(A)_IF_01.jpg?t=1716189430|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_N633-4(A)_IF_02.jpg?t=1716189430|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7255_aN633(A)_ChIP_01.jpg?t=1716189430 [Review] => 0 [Publication] => 69 [MoleculeName] => H3K9ac [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Acetyl-Histone H3-K27 Rabbit pAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,PTMantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1 [_Symbol] => H3-4 [_GeneID] => 8290/8350 [id] => 4476 [catid] => 722 [title] => Acetyl-Histone H3-K27 Rabbit pAb [url] => /catalog/A7253 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => A7253 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K27 [description] => Acetyl-Histone H3-K27 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC,IP,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:1000 - 1:5000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
IP,0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:20 - 1:100 [field_s8] => yes [field_s9] => Acetyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,PTM抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1 [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_aN2456(10-11-12)(A)_WB_01.jpg?t=1716189015|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_aN2456(10-11-12)(A)_WB_02.jpg?t=1716189015|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_aN2455(10-11-12)(A)_IHC_01.jpg?t=1716189015|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_aN2455(10-11-12)(A)_IHC_02.jpg?t=1716189015|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_aN2455(10-11-12)(A)_IHC_03.jpg?t=1716189015|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_aN2455(10-11-12)(A)_IHC_04.jpg?t=1716189015|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_N625(H)(A)(2)_IF_01.jpg?t=1716189015|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_N625(H)(A)(2)_IF_02.jpg?t=1716189015|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_N625(H)(A)(2)_IF_03.jpg?t=1716189015|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A7253_N15563-5(A)_ChIP_01.jpg?t=1716189015 [Review] => 1 [Publication] => 65 [MoleculeName] => H3K27ac [recommend] => 0 [status] => 1 [Symbol] => H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Phospho-Histone H2AX-S139 Rabbit pAb [_Synonyms] => H2A.X; H2A/X; H2AFX; Phospho-Histone H2AX-S139 [_keywords] => 3014, sc-67218, H2A histone family, member X, H2A.X, H2A/X, H2AFX, H2AX, Histone H2A.x, H2A histone family member X, histone H2AX, H2AX histone, histone H2A.x, P16104, H2afx, H2A Histone Family Member X, Histone H2A.X, H2A Histone Family, Member X, H2AX Histone, Histone H2AX, H2a/X, gamma H2A.X, GammaH2AX, gamma H2AX, Phospho-Histone H2AFX-S139, Phospho-H2AFX-S139, PhosphoH2AFX-S139, Phospho H2AFX-S139, 磷酸化, Phospho-Histone H2AX-S139,KO/KDantibody3014, sc-67218, H2A histone family, member X, H2A.X, H2A/X, H2AFX, H2AX, Histone H2A.x, H2A histone family member X, histone H2AX, H2AX histone, histone H2A.x, P16104, H2afx, H2A Histone Family Member X, Histone H2A.X, H2A Histone Family, Member X, H2AX Histone, Histone H2AX, H2a/X, gamma H2A.X, GammaH2AX, gamma H2AX, Phospho-Histone H2AFX-S139, Phospho-H2AFX-S139, PhosphoH2AFX-S139, Phospho H2AFX-S139, 磷酸化, Phospho-Histone H2AX-S139,PTMantibody3014, sc-67218, H2A histone family, member X, H2A.X, H2A/X, H2AFX, H2AX, Histone H2A.x, H2A histone family member X, histo [_Symbol] => H2AX [_GeneID] => 3014 [id] => 1959 [catid] => 414 [title] => Phospho-Histone H2AX-S139 Rabbit pAb [url] => /catalog/AP0099 [price] => 50 μL,1260,In Stock|100 μL,2050,In Stock|200 μL,3300,In Stock [CatalogNo] => AP0099 [Synonyms] => H2A.X; H2A/X; H2AFX; Phospho-Histone H2AX-S139 [description] => Phospho-Histone H2AX-S139 Rabbit pAb [applications] => ELISA,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic phosphorylated peptide around S139 of human Histone H2AX (NP_002096.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:100 - 1:500 [field_s8] => yes [field_s9] => Phospho S139 [field_s10] => Unconjugated [field_s12] => [keywords] => 3014, sc-67218, H2A histone family, member X, H2A.X, H2A/X, H2AFX, H2AX, Histone H2A.x, H2A histone family member X, histone H2AX, H2AX histone, histone H2A.x, P16104, H2afx, H2A Histone Family Member X, Histone H2A.X, H2A Histone Family, Member X, H2AX Histone, Histone H2AX, H2a/X, gamma H2A.X, γH2AX, gamma H2AX, Phospho-Histone H2AFX-S139, Phospho-H2AFX-S139, PhosphoH2AFX-S139, Phospho H2AFX-S139, 磷酸化, Phospho-Histone H2AX-S139,KO/KD抗体3014, sc-67218, H2A histone family, member X, H2A.X, H2A/X, H2AFX, H2AX, Histone H2A.x, H2A histone family member X, histone H2AX, H2AX histone, histone H2A.x, P16104, H2afx, H2A Histone Family Member X, Histone H2A.X, H2A Histone Family, Member X, H2AX Histone, Histone H2AX, H2a/X, gamma H2A.X, γH2AX, gamma H2AX, Phospho-Histone H2AFX-S139, Phospho-H2AFX-S139, PhosphoH2AFX-S139, Phospho H2AFX-S139, 磷酸化, Phospho-Histone H2AX-S139,PTM抗体3014, sc-67218, H2A histone family, member X, H2A.X, H2A/X, H2AFX, H2AX, Histone H2A.x, H2A histone family member X, histo [field_l3] => QASQEY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0099_N25378-8(P)_WB_02.jpg?t=1718354659|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0099_N25378-8(P)_WB_03.jpg?t=1718354659|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0099_N31849-5(P)_IHC_01.jpg?t=1718354659|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0099_N31849-5(P)_IHC_02.jpg?t=1718354659|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0099_N31849-5(P)_IHC_03.jpg?t=1718354659|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0099_N31849-5(P)_IHC_04.jpg?t=1718354659|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0099_N31846-5(P)_IF_02.jpg?t=1718354659 [Review] => 3 [Publication] => 61 [MoleculeName] => H2AFX [recommend] => 0 [status] => 1 [Symbol] => H2AX [posid] => 0 [GeneID] => Array ( [0] => 3014 ) [field_l6] => [readgroup] => [sbu_code] => 111 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Histone H3 Rabbit mAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Histone H3 [_keywords] => HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1|H3 histone family, member A|histone 1, H3a|histone H3/a|histone cluster 1, H3a, P68431, marker, Chromatin, Chromatin marker, CUT&Tag, Histone H3,KO/KDantibodyHIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1|H3 histone family, member A|histone 1, H3a|histone H3/a|histone cluster 1, H3a, P68431, marker, Chromatin, Chromatin marker, CUT&Tag, Histone H3,PTMantibody [_Symbol] => H3C1/H3-4 [_GeneID] => 8290/8350 [id] => 24080 [catid] => 130 [title] => Histone H3 Rabbit mAb [url] => /catalog/A17562 [price] => 50 μL,1200,In Stock|100 μL,2200,In Stock|200 μL,3100,In Stock [CatalogNo] => A17562 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Histone H3 [description] => Histone H3 Rabbit mAb [applications] => ELISA,WB,IHC-P,IF/ICC,ChIP [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin [field_s8] => [field_s9] => Unmodified [field_s10] => Unconjugated [field_s12] => [keywords] => HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1|H3 histone family, member A|histone 1, H3a|histone H3/a|histone cluster 1, H3a, P68431, marker, Chromatin, Chromatin marker, CUT&Tag, Histone H3,KO/KD抗体HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1|H3 histone family, member A|histone 1, H3a|histone H3/a|histone cluster 1, H3a, P68431, marker, Chromatin, Chromatin marker, CUT&Tag, Histone H3,PTM抗体 [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-01_WB_01.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-01_IHC_01.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-01_IHC_02.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-01_IHC_03.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-03_IF_03.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-03_IF_01.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-03_IF_02.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-01_ChIP_01.jpg?t=1715043362|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A17562_ARC50522-01_ChIP_02.jpg?t=1715043362 [Review] => 2 [Publication] => 11 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1/H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Acetyl-Histone H3-K27 Rabbit mAb [_Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K27 [_keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,KO/KDantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,PTMantibody8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1 [_Symbol] => H3C1/H3-4 [_GeneID] => 8290/8350 [id] => 33917 [catid] => 722 [title] => Acetyl-Histone H3-K27 Rabbit mAb [url] => /catalog/A22264 [price] => 50 μL,1400,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => A22264 [Synonyms] => H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; Acetyl-Histone H3-K27 [description] => Acetyl-Histone H3-K27 Rabbit mAb [applications] => ELISA,DB,WB,IHC-P,IF/ICC,ChIP,ChIP-seq [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 17kDa [field_s4] => A synthetic acetylated peptide around K27 of human Histone H3 (NP_003520.1). [field_s5] => Human [field_s6] => IgG [field_s7] => DB,1:2000 - 1:20000
WB,1:2000 - 1:20000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200
ChIP,5μg antibody for 5μg-10μg of Chromatin
ChIP-seq,1:50 - 1:200 [field_s8] => [field_s9] => Acetyl K27 [field_s10] => Unconjugated [field_s12] => [keywords] => 8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,KO/KD抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1t, Histone H3, HIST1H3A, Acetyl-Histone H3-K27, AcetylHistone H3-K27, Acetyl Histone H3-K27, H3K27ac, H3K27, marker, Chromatin, Chromatin marker,PTM抗体8290, HIST3H3, H3.4, H3/g, H3FT, H3t, histone cluster 3 H3, histone H3.1t, H3 histone family, member T, H3/t, histone 3, H3, Q16695, Histone Cluster 3 H3, H3 Histone Family, Member T, Histone 3, H3/G, H3/T, Histone Cluster 3, Histone H3.1 [field_l3] => MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_ChIP-seq_01.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_WB_01.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_WB_02.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_WB_03.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_DotBlot_01.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_IHC_01.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_IHC_02.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_IHC_03.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-03_IF_01.jpg?t=1715737209|https://abclonal.oss-cn-hangzhou.aliyuncs.com/A22264_ARC54943-01_ChIP_01.jpg?t=1715737209 [Review] => 0 [Publication] => 3 [MoleculeName] => [recommend] => 0 [status] => 1 [Symbol] => H3C1/H3-4 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 110 [datasheet] => [validation] => 0 [status_cn] => 1 )

Array ( [_title] => Phospho-Histone H3-S10 Rabbit mAb [_Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Phospho-Histone H3-S10 [_keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, 磷酸化, H3S10, 病理诊断antibody, IHC pathology, 病理诊断, marker, Chromatin, Chromatin marker, 病理診斷抗體, 病理診斷, Phospho-Histone H3-S10,KO/KDantibody8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histo [_Symbol] => H3C1 [_GeneID] => 8290/8350 [id] => 20239 [catid] => 414 [title] => Phospho-Histone H3-S10 Rabbit mAb [url] => /catalog/AP0002 [price] => 50 μL,1580,In Stock|100 μL,2500,In Stock|200 μL,4300,In Stock [CatalogNo] => AP0002 [Synonyms] => H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A; Phospho-Histone H3-S10 [description] => Phospho-Histone H3-S10 Rabbit mAb [applications] => ELISA,WB,IHC-P,IF/ICC [Species] => Rabbit [field_s1] => Human, Mouse, Rat, Other (Wide Range Predicted) [field_s2] => 15kDa [field_s3] => 15kDa [field_s4] => A synthetic phosphorylated peptide around S10 of human Histone H3 (P68431). [field_s5] => Human [field_s6] => IgG [field_s7] => WB,1:500 - 1:1000
IHC-P,1:50 - 1:200
IF/ICC,1:50 - 1:200 [field_s8] => [field_s9] => Phospho S10 [field_s10] => Unconjugated [field_s12] => [keywords] => 8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histone H3.1, Histone H3/B, Histone H3/C, Histone H3/D, Histone H3/F, Histone H3/H, Histone H3/I, Histone H3/J, Histone H3/K, Histone H3/L, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, Histone H3, succinylation-Histone H3-K79, H3K79suc, H3.4, H3/g, H3FT, H3t, HIST3H3, histone H3.1t, 磷酸化, H3S10, 病理诊断抗体, IHC pathology, 病理诊断, marker, Chromatin, Chromatin marker, 病理診斷抗體, 病理診斷, Phospho-Histone H3-S10,KO/KD抗体8350, HIST1H3A, H3/A, H3FA, histone cluster 1 H3 family member a, histone H3.1, H3 histone family, member A, histone 1, H3a, histone H3/a, histone cluster 1, P68431, Histone Cluster 1 H3 Family Member A, H3 Histone Family, Member A, Histone Cluster 1, Histone 1, Histone H3/A, Histo [field_l3] => ARKST [pics] => https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0002_ARC0003_WB_01.jpg?t=1716192984|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0002_ARC0003_IF_03.jpg?t=1716192984|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0002_ARC0003_IF_02.jpg?t=1716192984|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0002_ARC0003_IF_01.jpg?t=1716192984|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0002_ARC0003_IHC_01.jpg?t=1716192984|https://abclonal.oss-cn-hangzhou.aliyuncs.com/AP0002_ARC0003_IHC_02.jpg?t=1716192984 [Review] => 1 [Publication] => 2 [MoleculeName] => HIST1H3A [recommend] => 1 [status] => 1 [Symbol] => H3C1 [posid] => 0 [GeneID] => Array ( [0] => 8290 [1] => 8350 ) [field_l6] => [readgroup] => [sbu_code] => 113 [datasheet] => [validation] => 0 [status_cn] => 1 )